-- dump date   	20120504_141511
-- class       	Genbank::misc_feature
-- table       	misc_feature_note
-- id	note
218497000001	Porphobilinogen synthase (PBGS), which is also called delta-aminolevulinic acid dehydratase (ALAD), catalyzes the condensation of two 5-aminolevulinic acid (ALA) molecules to form the pyrrole porphobilinogen (PBG), which is the second step in the...; Region: ALAD_PBGS_aspartate_rich; cd04823
218497000002	dimer interface [polypeptide binding]; other site
218497000003	active site
218497000004	aspartate-rich active site metal binding site; other site
218497000005	allosteric magnesium binding site [ion binding]; other site
218497000006	Schiff base residues; other site
218497000007	Pfam match to entry PF00490 ALAD, Delta-aminolevulinic acid dehydratase , score 551.8, E-value 2.9e-163
218497000008	PS00169 Delta-aminolevulinic acid dehydratase active site.
218497000009	NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit; Region: nqrA; TIGR01936
218497000010	NQRA C-terminal domain; Region: NQRA_SLBB; pfam11973
218497000011	transcript cleavage factor/unknown domain fusion protein; Validated; Region: PRK06330
218497000012	domain; Region: GreA_GreB_N; pfam03449
218497000013	Transcription elongation factor, GreA/GreB, C-term; Region: GreA_GreB; pfam01272
218497000014	Pfam match to entry PF03449 GreA_GreB_N, Prokaryotic transcription elongation factor, GreA/GreB, N-terminal domain , score 29.9, E-value 1.9e-06
218497000015	aromatic amino acid aminotransferase; Provisional; Region: PRK09257
218497000016	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
218497000017	pyridoxal 5'-phosphate binding site [chemical binding]; other site
218497000018	homodimer interface [polypeptide binding]; other site
218497000019	catalytic residue [active]
218497000020	Pfam match to entry PF00155 aminotran_1_2, Aminotransferase class I and II , score 164.4, E-value 1.2e-46
218497000021	rod shape-determining protein MreC; Provisional; Region: PRK14872
218497000022	rod shape-determining protein MreC; Region: MreC; pfam04085
218497000023	1 probable transmembrane helix predicted for CAB006 by TMHMM2.0 at aa 68-85
218497000024	exodeoxyribonuclease V, beta subunit; Region: recB; TIGR00609
218497000025	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497000026	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497000027	Pfam match to entry PF00580 UvrD-helicase, UvrD/REP helicase , score 361.3, E-value 6.5e-106
218497000028	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000029	Exonuclease V gamma subunit [DNA replication, recombination, and repair]; Region: RecC; COG1330
218497000030	Exodeoxyribonuclease V, gamma subunit; Region: Exonuc_V_gamma; cl15476
218497000031	H+ Antiporter protein; Region: 2A0121; TIGR00900
218497000032	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
218497000033	putative substrate translocation pore; other site
218497000034	10 probable transmembrane helices predicted for CAB009 by TMHMM2.0 at aa 17-39, 52-74, 95-117, 177-199, 231-253, 268-290, 295-317, 322-344, 357-379 and 389-408
218497000035	putative rhodanese-related sulfurtransferase; Provisional; Region: PRK00142
218497000036	Member of the Rhodanese Homology Domain superfamily. This CD includes Escherichia coli YceA, Bacillus subtilis YbfQ, and similar uncharacterized proteins; Region: RHOD_YceA; cd01518
218497000037	active site residue [active]
218497000038	Pfam match to entry PF00581 Rhodanese, Rhodanese-like domain , score 53.3, E-value 3.5e-13
218497000039	Ribosomal protein S4/S9 N-terminal domain; Region: Ribosomal_S4; pfam00163
218497000040	ribosomal protein S4, bacterial/organelle type; Region: rpsD_bact; TIGR01017
218497000041	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
218497000042	RNA binding surface [nucleotide binding]; other site
218497000043	Pfam match to entry PF00163 Ribosomal_S4, Ribosomal protein S4/S9 N-terminal domain , score 73.5, E-value 2.9e-19
218497000044	Pfam match to entry PF01479 S4, S4 domain , score 75.0, E-value 1e-19
218497000045	endonuclease IV; Provisional; Region: PRK01060
218497000046	AP endonuclease family 2; These endonucleases play a role in DNA repair. Cleave phosphodiester bonds at apurinic or apyrimidinic sites; the alignment also contains hexulose-6-phosphate isomerases, enzymes that catalyze the epimerization of...; Region: AP2Ec; cd00019
218497000047	AP (apurinic/apyrimidinic) site pocket; other site
218497000048	DNA interaction; other site
218497000049	Metal-binding active site; metal-binding site
218497000050	Pfam match to entry PF01261 AP_endonuc_2, AP endonuclease 2 , score 318.5, E-value 5.1e-93
218497000051	PS00730 AP endonucleases family 2 signature 2.
218497000052	MviN-like protein; Region: MVIN; pfam03023
218497000053	13 probable transmembrane helices predicted for CAB013 by TMHMM2.0 at aa 33-52, 96-118, 128-150, 157-176, 186-208, 229-248, 268-290, 310-332, 352-374, 381-403, 408-427, 448-470 and 490-512
218497000054	Pfam match to entry PF03023 MVIN, Virulence factor MVIN , score 547.7, E-value 5.3e-162
218497000055	Signal peptide predicted for CAB014 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.981 between residues 23 and 24
218497000056	PS00030 Eukaryotic  RNA-binding region RNP-1 signature.
218497000057	Protein of unknown function, DUF582; Region: DUF582; pfam04518
218497000058	Protein of unknown function, DUF582; Region: DUF582; pfam04518
218497000059	ABC-type (unclassified) transport system, ATPase component [General function prediction only]; Region: YhbG; COG1137
218497000060	The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids. The genes yhbG and yhbN are located in a single operon and may function together in...; Region: ABC_YhbG; cd03218
218497000061	Walker A/P-loop; other site
218497000062	ATP binding site [chemical binding]; other site
218497000063	Q-loop/lid; other site
218497000064	ABC transporter signature motif; other site
218497000065	Walker B; other site
218497000066	D-loop; other site
218497000067	H-loop/switch region; other site
218497000068	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 172.2, E-value 5.7e-49
218497000069	PS00211 ABC transporters family signature.
218497000070	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000071	Protein of unknown function (DUF1137); Region: DUF1137; pfam06587
218497000072	Signal peptide predicted for CAB020 by SignalP 2.0 HMM (Signal peptide probabilty 0.965) with cleavage site probability 0.644 between residues 25 and 26
218497000073	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000074	NeuB family; Region: NeuB; cl00496
218497000075	DAHP synthetase I family; Region: DAHP_synth_1; pfam00793
218497000076	Pfam match to entry PF00793 DAHP_synth_1, DAHP synthetase I family , score 440.1, E-value 1.2e-129
218497000077	Predicted RNA-binding protein (contains KH domain) [General function prediction only]; Region: COG1837; cl00794
218497000078	Pfam match to entry PF00013 KH, KH domain , score 21.6, E-value 0.00063
218497000079	Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]; Region: RluA; COG0564
218497000080	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
218497000081	RNA binding surface [nucleotide binding]; other site
218497000082	PseudoU_synth_RsuA/RluD: Pseudouridine synthase, RsuA/RluD family. This group is comprised of eukaryotic, bacterial and archeal proteins similar to eight site specific Escherichia coli pseudouridine synthases: RsuA, RluA, RluB, RluC, RluD, RluE, RluF and...; Region: PseudoU_synth_RluCD_like; cd02869
218497000083	active site
218497000084	Pfam match to entry PF00849 PseudoU_synth_2, RNA pseudouridylate synthase , score 236.6, E-value 2.2e-68
218497000085	Pfam match to entry PF01479 S4, S4 domain , score 44.4, E-value 1.7e-10
218497000086	DNA Topoisomerase IV; Region: TOP4c; smart00434
218497000087	DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II. DNA topoisomerases are essential enzymes that regulate the conformational changes in DNA...; Region: TOP4c; cl00148
218497000088	CAP-like domain; other site
218497000089	active site
218497000090	Pfam match to entry PF00521 DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A , score 159.9, E-value 2.8e-45
218497000091	DNA topoisomerase IV subunit B; Reviewed; Region: PRK05559
218497000092	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cl00075
218497000093	MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of type II DNA topoisomerases (Topo II) and DNA mismatch repair (MutL/MLH1/PMS2) proteins. This transducer domain is homologous to the second...; Region: TopoII_MutL_Trans; cl02783
218497000094	ATP binding site [chemical binding]; other site
218497000095	TOPRIM_TopoIIA_like: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to Saccharomyces cerevisiae Topoisomerase II. TopoIIA enzymes cut both strands...; Region: TOPRIM_TopoIIA_like; cd01030
218497000096	active site
218497000097	putative metal-binding site [ion binding]; other site
218497000098	DNA gyrase B subunit, carboxyl terminus; Region: DNA_gyraseB_C; pfam00986
218497000099	Pfam match to entry PF01751 Toprim, Toprim domain , score 18.7, E-value 7.2e-05
218497000100	Pfam match to entry PF00204 DNA_gyraseB, DNA gyrase B , score 92.9, E-value 4.1e-25
218497000101	Pfam match to entry PF02518 HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase , score 52.2, E-value 7.6e-13
218497000102	glutamyl-tRNA reductase; Validated; Region: hemA; PRK00676
218497000103	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497000104	NAD(P) binding pocket [chemical binding]; other site
218497000105	Tir chaperone protein (CesT); Region: CesT; cl08444
218497000106	Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins...; Region: FHA; cd00060
218497000107	phosphopeptide binding site; other site
218497000108	Forkhead associated domain (FHA); found in eukaryotic and prokaryotic proteins. Putative nuclear signalling domain. FHA domains may bind phosphothreonine, phosphoserine and sometimes phosphotyrosine. In eukaryotes, many FHA domain-containing proteins...; Region: FHA; cd00060
218497000109	type III secretion apparatus protein, YscD/HrpQ family; Region: type_III_yscD; TIGR02500
218497000110	phosphopeptide binding site; other site
218497000111	BON domain; Region: BON; cl02771
218497000112	Pfam match to entry PF00498 FHA, FHA domain , score 41.0, E-value 1.8e-09
218497000113	Pfam match to entry PF00498 FHA, FHA domain , score 53.5, E-value 3.1e-13
218497000114	1 probable transmembrane helix predicted for CAB031 by TMHMM2.0 at aa 494-516
218497000115	type III secretion system ATPase; Provisional; Region: PRK06315
218497000116	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; cl15275
218497000117	Flagellum-specific ATPase/type III secretory pathway virulence-related protein. This group of ATPases are responsible for the export of flagellum and virulence-related proteins. The bacterial flagellar motor is similar to the F0F1-ATPase, in that they...; Region: ATPase_flagellum-secretory_path_III; cd01136
218497000118	Walker A motif/ATP binding site; other site
218497000119	Walker B motif; other site
218497000120	Pfam match to entry PF02874 ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain , score 38.1, E-value 1.3e-08
218497000121	Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain , score 498.1, E-value 4.3e-147
218497000122	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000123	PS00152 ATP synthase alpha and beta subunits signature.
218497000124	type III secretion system protein; Validated; Region: PRK05933
218497000125	Surface presentation of antigens (SPOA); Region: SpoA; cl00819
218497000126	Pfam match to entry PF01052 SpoA, Surface presentation of antigens (SPOA) protein , score 50.0, E-value 3.5e-12
218497000127	Serine/Threonine protein kinases, catalytic domain; Region: S_TKc; smart00220
218497000128	Catalytic domain of Protein Kinases; Region: PKc; cd00180
218497000129	active site
218497000130	ATP binding site [chemical binding]; other site
218497000131	substrate binding site [chemical binding]; other site
218497000132	activation loop (A-loop); other site
218497000133	Pfam match to entry PF00069 pkinase, Protein kinase domain , score 164.7, E-value 1e-46
218497000134	PS00108 Serine/Threonine protein kinases active-site signature.
218497000135	Type II secretory pathway, component PulD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: PulD; COG1450
218497000136	Bacterial type II/III secretion system short domain; Region: Secretin_N; pfam03958
218497000137	Bacterial type II/III secretion system short domain; Region: Secretin_N; pfam03958
218497000138	Bacterial type II and III secretion system protein; Region: Secretin; pfam00263
218497000139	Signal peptide predicted for CAB041 by SignalP 2.0 HMM (Signal peptide probabilty 0.858) with cleavage site probability 0.423 between residues 38 and 39
218497000140	Pfam match to entry PF00263 GSPII_III, Bacterial type II and III secretion system protein , score 282.3, E-value 4e-82
218497000141	ATP:guanido phosphotransferase; Provisional; Region: PRK01059
218497000142	Phosphagen (guanidino) kinases; Region: phosphagen_kinases; cl02823
218497000143	ADP binding site [chemical binding]; other site
218497000144	phosphagen binding site; other site
218497000145	substrate specificity loop; other site
218497000146	Pfam match to entry PF00217 ATP-gua_Ptrans, ATP:guanido phosphotransferase, C-terminal catalytic domain , score -94.5, E-value 0.00042
218497000147	Modulator of heat shock repressor CtsR, McsA [Signal transduction    mechanisms]; Region: COG3880
218497000148	UvrB/uvrC motif; Region: UVR; pfam02151
218497000149	Pfam match to entry PF02151 UVR, UvrB/uvrC motif , score 34.1, E-value 2.1e-07
218497000150	Ribosome recycling factor (RRF). Ribosome recycling factor dissociates the posttermination complex, composed of the ribosome, deacylated tRNA, and mRNA, after termination of translation.  Thus ribosomes are 'recycled' and ready for another round of...; Region: RRF; cd00520
218497000151	hinge region; other site
218497000152	Pfam match to entry PF01765 RRF, Ribosome recycling factor , score 253.6, E-value 1.7e-73
218497000153	UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and...; Region: AAK_UMPK-PyrH-Ec; cd04254
218497000154	putative nucleotide binding site [chemical binding]; other site
218497000155	uridine monophosphate binding site [chemical binding]; other site
218497000156	homohexameric interface [polypeptide binding]; other site
218497000157	Pfam match to entry PF00696 aakinase, Amino acid kinase , score 181.0, E-value 1.3e-51
218497000158	elongation factor Ts; Provisional; Region: tsf; PRK09377
218497000159	Ubiquitin Associated domain. The UBA domain is a commonly occurring sequence motif in some members of the ubiquitination pathway, UV excision repair proteins, and certain protein kinases. Although its specific role is so far unknown, it has been...; Region: UBA; cl00153
218497000160	Elongation factor TS; Region: EF_TS; pfam00889
218497000161	Elongation factor TS; Region: EF_TS; pfam00889
218497000162	Pfam match to entry PF00889 EF_TS, Elongation factor TS , score 326.7, E-value 1.8e-95
218497000163	PS01127 Elongation factor Ts signature 2.
218497000164	Pfam match to entry PF00627 UBA, UBA/TS-N domain , score 40.6, E-value 2.3e-09
218497000165	PS01126 Elongation factor Ts signature 1.
218497000166	Ribosomal protein S2 (RPS2), involved in formation of the translation initiation complex, where it might contact the messenger RNA and several components of the ribosome. It has been shown that in Escherichia coli RPS2 is essential for the binding of...; Region: RPS2; cd01425
218497000167	rRNA interaction site [nucleotide binding]; other site
218497000168	S8 interaction site; other site
218497000169	Pfam match to entry PF00318 Ribosomal_S2, Ribosomal protein S2 , score 306.7, E-value 1.8e-89
218497000170	PS00963 Ribosomal protein S2 signature 2.
218497000171	PS00962 Ribosomal protein S2 signature 1.
218497000172	Chlamydia major outer membrane protein; Region: Chlam_OMP; pfam01308
218497000173	Pfam match to entry PF01308 Chlamydia_OMP, Chlamydia major outer membrane protein , score 970.8, E-value 2.2e-289
218497000174	Signal peptide predicted for CAB048 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.932 between residues 22 and 23
218497000175	Penicillin-binding Protein dimerisation domain; Region: PBP_dimer; pfam03717
218497000176	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl01009
218497000177	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl01009
218497000178	Signal peptide predicted for CAB049 by SignalP 2.0 HMM (Signal peptide probabilty 0.665) with cleavage site probability 0.279 between residues 42 and 43
218497000179	Pfam match to entry PF03717 PBP_dimer, Penicillin-binding Protein dimerisation domain , score 158.2, E-value 9.4e-45
218497000180	Pfam match to entry PF00905 Transpeptidase, Penicillin binding protein transpeptidase domain , score 22.7, E-value 1.2e-06
218497000181	Pfam match to entry PF00905 Transpeptidase, Penicillin binding protein transpeptidase domain , score -32.1, E-value 2.9e-08
218497000182	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497000183	TPR motif; other site
218497000184	binding surface
218497000185	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497000186	binding surface
218497000187	TPR motif; other site
218497000188	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497000189	binding surface
218497000190	TPR motif; other site
218497000191	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cl02429
218497000192	binding surface
218497000193	TPR motif; other site
218497000194	Pfam match to entry PF00515 TPR, TPR Domain , score 8.7, E-value 0.34
218497000195	Pfam match to entry PF00515 TPR, TPR Domain , score 23.3, E-value 0.00037
218497000196	Pfam match to entry PF00515 TPR, TPR Domain , score 1.6, E-value 2
218497000197	Pfam match to entry PF00515 TPR, TPR Domain , score 46.2, E-value 4.8e-11
218497000198	Pfam match to entry PF00515 TPR, TPR Domain , score 16.8, E-value 0.034
218497000199	Pfam match to entry PF00515 TPR, TPR Domain , score 31.9, E-value 9.3e-07
218497000200	Pfam match to entry PF00515 TPR, TPR Domain , score 34.8, E-value 1.3e-07
218497000201	Pfam match to entry PF00515 TPR, TPR Domain , score 25.3, E-value 9e-05
218497000202	Pfam match to entry PF00515 TPR, TPR Domain , score 8.7, E-value 0.34
218497000203	Uncharacterized protein family (UPF0051); Region: UPF0051; cl03223
218497000204	putative ABC transporter; Region: ycf24; CHL00085
218497000205	Pfam match to entry PF01458 UPF0051, Uncharacterized protein family (UPF0051) , score 430.1, E-value 1.3e-126
218497000206	FeS assembly ATPase SufC; Region: sufC; TIGR01978
218497000207	ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under...; Region: ABC_FeS_Assembly; cd03217
218497000208	Walker A/P-loop; other site
218497000209	ATP binding site [chemical binding]; other site
218497000210	Q-loop/lid; other site
218497000211	ABC transporter signature motif; other site
218497000212	Walker B; other site
218497000213	D-loop; other site
218497000214	H-loop/switch region; other site
218497000215	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 104.7, E-value 1.2e-28
218497000216	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000217	Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones]; Region: SufB; COG0719
218497000218	Uncharacterized protein family (UPF0051); Region: UPF0051; cl03223
218497000219	Pfam match to entry PF01458 UPF0051, Uncharacterized protein family (UPF0051) , score 78.0, E-value 1.3e-20
218497000220	Cysteine desulfurase (SufS)-like. This family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to cysteine desulfurase (SufS) and selenocysteine lyase. SufS...; Region: SufS_like; cd06453
218497000221	Aminotransferase class-V; Region: Aminotran_5; pfam00266
218497000222	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
218497000223	catalytic residue [active]
218497000224	Pfam match to entry PF00266 aminotran_5, Aminotransferase class-V , score 57.8, E-value 1.6e-14
218497000225	PS00595 Aminotransferases class-V pyridoxal-phosphate attachment site.
218497000226	Polysaccharide deacetylase; Region: Polysacc_deac_1; cl12061
218497000227	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000228	1 probable transmembrane helix predicted for CAB056 by TMHMM2.0 at aa 15-37
218497000229	ParB-like partition proteins; Region: parB_part; TIGR00180
218497000230	ParB-like nuclease domain; Region: ParBc; cl02129
218497000231	Pfam match to entry PF02195 ParBc, ParB-like nuclease domain , score 125.9, E-value 4.7e-35
218497000232	Predicted helix-turn-helix motif with score 1525.000, SD 4.38 at aa 129-150, sequence LTQDKVAVRVGKKRSTVANYLR
218497000233	dipeptide transporter ATP-binding subunit; Provisional; Region: dppF; PRK11308
218497000234	The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane...; Region: ABC_NikE_OppD_transporters; cd03257
218497000235	Walker A/P-loop; other site
218497000236	ATP binding site [chemical binding]; other site
218497000237	Q-loop/lid; other site
218497000238	ABC transporter signature motif; other site
218497000239	Walker B; other site
218497000240	D-loop; other site
218497000241	H-loop/switch region; other site
218497000242	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
218497000243	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 192.7, E-value 3.8e-55
218497000244	PS00211 ABC transporters family signature.
218497000245	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000246	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppD; COG0444
218497000247	The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane...; Region: ABC_NikE_OppD_transporters; cd03257
218497000248	Walker A/P-loop; other site
218497000249	ATP binding site [chemical binding]; other site
218497000250	Q-loop/lid; other site
218497000251	ABC transporter signature motif; other site
218497000252	Walker B; other site
218497000253	D-loop; other site
218497000254	H-loop/switch region; other site
218497000255	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
218497000256	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 185.1, E-value 7.5e-53
218497000257	PS00211 ABC transporters family signature.
218497000258	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000259	Protein of unknown function DUF47; Region: PhoU_div; pfam01865
218497000260	Pfam match to entry PF01865 DUF47, Protein of unknown function DUF47 , score 255.5, E-value 4.7e-74
218497000261	Phosphate transporter family; Region: PHO4; cl00396
218497000262	Phosphate transporter family; Region: PHO4; cl00396
218497000263	11 probable transmembrane helices predicted for CAB061 by TMHMM2.0 at aa 2-21, 83-105, 112-134, 138-160, 181-203, 207-224, 260-282, 308-330, 351-370, 374-396 and 403-425
218497000264	Pfam match to entry PF01384 PHO4, Phosphate transporter family , score 584.6, E-value 4.1e-173
218497000265	Phosphoglycerate kinase (PGK) is a monomeric enzyme which catalyzes the transfer of the high-energy phosphate group of 1,3-bisphosphoglycerate to ADP, forming ATP and 3-phosphoglycerate. This reaction represents the first of the two substrate-level...; Region: Phosphoglycerate_kinase; cd00318
218497000266	substrate binding site [chemical binding]; other site
218497000267	hinge regions; other site
218497000268	ADP binding site [chemical binding]; other site
218497000269	catalytic site [active]
218497000270	Pfam match to entry PF00162 PGK, Phosphoglycerate kinase , score 651.6, E-value 2.6e-193
218497000271	PS00111 Phosphoglycerate kinase signature.
218497000272	Similar to many including: Chlamydophila caviae nol1/nop2/sun family protein cca00065 SWALL:Q824S4 (EMBL:AE016994) (371 aa) fasta scores: E(): 3.1e-126, 85.67% id in 370 aa and to Plasmodium yoelii yoelii RNA methyltransferase,  py03774 SWALL:Q7RI56 (EMBL:AABL01001110) (376 aa) fasta scores: E(): 1.2e-26, 36.38% id in 382 aa. Note this CDS carries multiple frameshift mutations and lacks an appropriate translational start codon;conserved hypothetical protein (pseudogene)
218497000273	Pfam match to entry PF01189 Nol1_Nop2_Sun, NOL1/NOP2/sun family , score 38.1, E-value 1e-09
218497000274	Signal peptide predicted for CAB068 by SignalP 2.0 HMM (Signal peptide probabilty 0.993) with cleavage site probability 0.722 between residues 20 and 21
218497000275	D-alanyl-D-alanine carboxypeptidase [Cell envelope biogenesis, outer membrane]; Region: DacC; COG1686
218497000276	1 probable transmembrane helix predicted for CAB069 by TMHMM2.0 at aa 401-418
218497000277	Pfam match to entry PF00768 Peptidase_S11, D-alanyl-D-alanine carboxypeptidase , score 87.4, E-value 1.9e-23
218497000278	Signal peptide predicted for CAB069 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.999 between residues 24 and 25
218497000279	Similar to Chlamydia trachomatis hypothetical protein Ct550 SWALL:O84554 (EMBL:AE001325) (141 aa) fasta scores: E(): 1.5e-20, 64.04% id in 89 aa. Only significant full-length database matches are to predicted Chlamydiaceae proteins. The CDS contains a probable frameshift mutation following codon 94.;conserved hypothetical protein (pseudogene)
218497000280	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cl00075
218497000281	Pfam match to entry PF02518 HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase , score 28.1, E-value 1.3e-05
218497000282	Signal peptide predicted for CAB072 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.749 between residues 22 and 23
218497000283	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000284	DNA uptake lipoprotein [General function prediction only]; Region: ComL; COG4105
218497000285	Pfam match to entry PF00515 TPR, TPR Domain , score 14.3, E-value 0.084
218497000286	Pfam match to entry PF00515 TPR, TPR Domain , score 11.1, E-value 0.19
218497000287	Pfam match to entry PF00515 TPR, TPR Domain , score 14.2, E-value 0.087
218497000288	Pfam match to entry PF00515 TPR, TPR Domain , score 5.4, E-value 0.78
218497000289	Signal peptide predicted for CAB073 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.995 between residues 20 and 21
218497000290	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000291	1 probable transmembrane helix predicted for CAB074 by TMHMM2.0 at aa 5-22
218497000292	DNA polymerase III subunit alpha; Validated; Region: dnaE; PRK05673
218497000293	DNA polymerase alpha chain like domain; Region: POLIIIAc; smart00481
218497000294	Bacterial DNA polymerase III alpha subunit; Region: DNA_pol3_alpha; pfam07733
218497000295	DnaE_OBF: A subfamily of OB folds corresponding to the C-terminal OB-fold nucleic acid binding domain of Thermus aquaticus and Escherichia coli type C replicative DNA polymerase III alpha subunit (DnaE). The DNA polymerase holoenzyme of E. coli contains...; Region: DnaE_OBF; cd04485
218497000296	generic binding surface I; other site
218497000297	generic binding surface II; other site
218497000298	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000299	Pfam match to entry PF02811 PHP_C, PHP domain C-terminal region , score 136.7, E-value 2.8e-38
218497000300	Pfam match to entry PF02231 PHP_N, PHP domain N-terminal region , score 119.9, E-value 3.2e-33
218497000301	Sugar phosphate permease [Carbohydrate transport and metabolism]; Region: UhpC; COG2271
218497000302	The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters. MFS proteins facilitate the transport across cytoplasmic or internal membranes of a variety of...; Region: MFS; cd06174
218497000303	putative substrate translocation pore; other site
218497000304	10 probable transmembrane helices predicted for CAB076 by TMHMM2.0 at aa 29-48, 68-90, 103-125, 186-205, 263-282, 302-321, 334-351, 361-383, 390-412 and 422-444
218497000305	PS00942 glpT family of transporters signature.
218497000306	PS00340 Growth factor and cytokines receptors family signature 2.
218497000307	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
218497000308	Signal peptide predicted for CAB077 by SignalP 2.0 HMM (Signal peptide probabilty 0.625) with cleavage site probability 0.513 between residues 19 and 20
218497000309	histidyl-tRNA synthetase; Reviewed; Region: hisS; PRK00037
218497000310	Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain. HisRS is a homodimer. It is responsible for the attachment of histidine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: HisRS-like_core; cd00773
218497000311	dimer interface [polypeptide binding]; other site
218497000312	motif 1; other site
218497000313	active site
218497000314	motif 2; other site
218497000315	motif 3; other site
218497000316	HisRS Histidyl-anticodon binding domain. HisRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is...; Region: HisRS_anticodon; cd00859
218497000317	anticodon binding site; other site
218497000318	Pfam match to entry PF00587 tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) , score 149.0, E-value 5.4e-42
218497000319	Pfam match to entry PF03129 HGTP_anticodon, Anticodon binding domain , score 47.9, E-value 1.5e-11
218497000320	aspartyl-tRNA synthetase; Validated; Region: aspS; PRK00476
218497000321	EcAspRS_like_N: N-terminal, anticodon recognition domain of the type found in Escherichia coli aspartyl-tRNA synthetase (AspRS), the human mitochondrial (mt) AspRS-2, the discriminating (D) Thermus thermophilus AspRS-1, and the nondiscriminating (ND)...; Region: EcAspRS_like_N; cd04317
218497000322	dimer interface [polypeptide binding]; other site
218497000323	anticodon binding site; other site
218497000324	Asp tRNA synthetase (aspRS) class II core domain. Class II assignment is based upon its structure and the presence of three characteristic sequence motifs. AspRS is a homodimer, which attaches a specific amino acid to the 3' OH group of ribose of the...; Region: AspRS_core; cd00777
218497000325	homodimer interface [polypeptide binding]; other site
218497000326	motif 1; other site
218497000327	active site
218497000328	motif 2; other site
218497000329	GAD domain; Region: GAD; pfam02938
218497000330	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it attaches...; Region: class_II_aaRS-like_core; cl00268
218497000331	active site
218497000332	motif 3; other site
218497000333	PS00527 Ribosomal protein S14 signature.
218497000334	Pfam match to entry PF01336 tRNA_anti, OB-fold nucleic acid binding domain , score 79.3, E-value 5e-21
218497000335	Pfam match to entry PF00152 tRNA-synt_2, tRNA synthetases class II (D, K and N) , score 80.5, E-value 2.3e-21
218497000336	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
218497000337	Pfam match to entry PF02938 GAD, GAD domain , score 157.1, E-value 2e-44
218497000338	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497000339	FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones]; Region: FkpA; COG0545
218497000340	Domain amino terminal to FKBP-type peptidyl-prolyl isomerase; Region: FKBP_N; pfam01346
218497000341	FKBP-type peptidyl-prolyl cis-trans isomerase; Region: FKBP_C; cl11587
218497000342	Signal peptide predicted for CAB080 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.916 between residues 20 and 21
218497000343	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000344	Pfam match to entry PF01346 FKBP_N, Domain amino terminal to FKBP-type peptidyl-prolyl isomerase , score 20.1, E-value 8.3e-05
218497000345	Pfam match to entry PF00254 FKBP, FKBP-type peptidyl-prolyl cis-trans isomerase , score 109.3, E-value 4.8e-30
218497000346	SpoU rRNA Methylase family; Region: SpoU_methylase; cl00362
218497000347	Pfam match to entry PF00588 SpoU_methylase, SpoU rRNA Methylase , score 101.6, E-value 1e-27
218497000348	TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox...; Region: TRX_family; cd02947
218497000349	catalytic residues [active]
218497000350	Pfam match to entry PF00085 thiored, Thioredoxin , score 140.1, E-value 2.6e-39
218497000351	PS00194 Thioredoxin family active site.
218497000352	Protein of unknown function (DUF2709); Region: DUF2709; pfam10915
218497000353	Uncharacterised P-loop hydrolase UPF0079; Region: UPF0079; cl00520
218497000354	Pfam match to entry PF02367 UPF0079, Uncharacterised P-loop hydrolase UPF0079 , score 165.7, E-value 4.9e-47
218497000355	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000356	DNA polymerase III subunit epsilon; Validated; Region: PRK06310
218497000357	DEDDh 3'-5' exonuclease domain family; Region: DEDDh; cd06127
218497000358	active site
218497000359	substrate binding site [chemical binding]; other site
218497000360	catalytic site [active]
218497000361	Protein of unknown function (DUF3820); Region: DUF3820; cl01411
218497000362	Pfam match to entry PF00929 Exonuclease, Exonuclease , score 193.6, E-value 2e-55
218497000363	Brown fat-inducible thioesterase (BFIT).  Brain acyl-CoA hydrolase (BACH).  These enzymes deacylate long-chain fatty acids by hydrolyzing acyl-CoA thioesters to free fatty acids and CoA-SH. Eukaryotic members of this family are expressed in brain, testis; Region: BFIT_BACH; cd03442
218497000364	Pfam match to entry PF01662 Acyl-CoA_hydro, Cytosolic long-chain acyl-CoA thioester hydrolase , score 88.7, E-value 7.9e-24
218497000365	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
218497000366	apolipoprotein N-acyltransferase; Reviewed; Region: lnt; PRK00302
218497000367	Apolipoprotein N-acyl transferase (class 9 nitrilases); Region: ALP_N-acyl_transferase; cd07571
218497000368	putative active site [active]
218497000369	catalytic triad [active]
218497000370	putative dimer interface [polypeptide binding]; other site
218497000371	Signal peptide predicted for CAB087 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.965 between residues 17 and 18
218497000372	7 probable transmembrane helices predicted for CAB087 by TMHMM2.0 at aa 22-41, 48-70, 85-107, 116-135, 160-182, 189-206 and 513-535
218497000373	Pfam match to entry PF00795 CN_hydrolase, Carbon-nitrogen hydrolase , score -95.1, E-value 0.0014
218497000374	UDP-3-O-acyl N-acetylglycosamine deacetylase; Region: LpxC; pfam03331
218497000375	UDP-3-O-acyl-N-acetylglucosamine deacetylase [Cell envelope biogenesis, outer membrane]; Region: LpxC; cl00512
218497000376	Pfam match to entry PF03331 LpxC, UDP-3-O-acyl N-acetylglycosamine deacetylase , score 571.5, E-value 3.6e-169
218497000377	FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid...; Region: FabZ; cd01288
218497000378	Pfam match to entry PF01377 Thioester_dehyd, Thioester dehydrase , score 154.9, E-value 8.8e-44
218497000379	UDP-N-acetylglucosamine acyltransferase; Provisional; Region: PRK05289
218497000380	UDP-N-acetylglucosamine O-acyltransferase (UDP-GlcNAc acyltransferase): Proteins in this family catalyze the transfer of (R)-3-hydroxymyristic acid from its acyl carrier protein thioester to UDP-GlcNAc. It is the first enzyme in the lipid A biosynthetic...; Region: LbH_UDP-GlcNAc_AT; cd03351
218497000381	active site
218497000382	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 16.3, E-value 0.049
218497000383	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 5.1, E-value 11
218497000384	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 17.3, E-value 0.024
218497000385	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 16.2, E-value 0.053
218497000386	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 19.3, E-value 0.0061
218497000387	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 14.3, E-value 0.19
218497000388	PS00101 Hexapeptide-repeat containing-transferases signature.
218497000389	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 15.1, E-value 0.11
218497000390	methionyl-tRNA formyltransferase; Reviewed; Region: fmt; PRK00005
218497000391	Methionyl-tRNA formyltransferase, N-terminal hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N; cd08646
218497000392	putative active site [active]
218497000393	substrate binding site [chemical binding]; other site
218497000394	putative cosubstrate binding site; other site
218497000395	catalytic site [active]
218497000396	C-terminal domain of Formyltransferase and other enzymes; Region: Met_tRNA_FMT_C; cd08704
218497000397	substrate binding site [chemical binding]; other site
218497000398	Pfam match to entry PF00551 formyl_transf, Formyl transferase , score 140.0, E-value 2.8e-39
218497000399	Pfam match to entry PF02911 formyl_trans_C, Formyl transferase, C-terminal domain , score 135.1, E-value 8.4e-38
218497000400	Ribosomal protein L3; Region: Ribosomal_L3; cl00324
218497000401	Pfam match to entry PF00297 Ribosomal_L3, Ribosomal protein L3 , score 198.9, E-value 5.3e-57
218497000402	PS00474 Ribosomal protein L3 signature.
218497000403	Ribosomal protein L4/L1 family; Region: Ribosomal_L4; cl00325
218497000404	Pfam match to entry PF00573 Ribosomal_L4, Ribosomal protein L4/L1 family , score 234.2, E-value 1.2e-67
218497000405	Ribosomal protein L23; Region: Ribosomal_L23; cl00326
218497000406	PS00215 Mitochondrial energy transfer proteins signature.
218497000407	Pfam match to entry PF00276 Ribosomal_L23, Ribosomal protein L23 , score 22.4, E-value 5.6e-05
218497000408	50S ribosomal protein L2; Validated; Region: rplB; PRK09374
218497000409	Ribosomal Proteins L2, RNA binding domain; Region: Ribosomal_L2; pfam00181
218497000410	Ribosomal Proteins L2, C-terminal domain; Region: Ribosomal_L2_C; pfam03947
218497000411	Pfam match to entry PF00181 Ribosomal_L2, Ribosomal Proteins L2, RNA binding domain , score 162.2, E-value 5.8e-46
218497000412	Pfam match to entry PF03947 Ribosomal_L2_C, Ribosomal Proteins L2, C-terminal domain , score 269.9, E-value 2.2e-78
218497000413	PS00467 Ribosomal protein L2 signature.
218497000414	Ribosomal protein S19; Region: Ribosomal_S19; cl00350
218497000415	Pfam match to entry PF00203 Ribosomal_S19, Ribosomal protein S19 , score 157.0, E-value 2.2e-44
218497000416	PS00323 Ribosomal protein S19 signature.
218497000417	Ribosomal protein L22/L17e.  L22 (L17 in eukaryotes) is a core protein of the large ribosomal subunit.  It is the only ribosomal protein that interacts with all six domains of 23S rRNA, and is one of the proteins important for directing the proper...; Region: Ribosomal_L22; cd00336
218497000418	putative translocon binding site; other site
218497000419	protein-rRNA interface [nucleotide binding]; other site
218497000420	Pfam match to entry PF00237 Ribosomal_L22, Ribosomal protein L22p/L17e , score 83.3, E-value 3.2e-22
218497000421	ribosomal protein S3, bacterial type; Region: rpsC_bact; TIGR01009
218497000422	K homology RNA-binding (KH) domain of the prokaryotic 30S small ribosomal subunit protein S3. S3  is part of the head region of the 30S ribosomal subunit and is believed to interact with mRNA as it threads its way from the latch into the channel.  The KH...; Region: 30S_S3_KH; cd02412
218497000423	G-X-X-G motif; other site
218497000424	Ribosomal protein S3, C-terminal domain; Region: Ribosomal_S3_C; pfam00189
218497000425	Pfam match to entry PF00417 Ribosomal_S3_N, Ribosomal protein S3, N-terminal domain , score 60.7, E-value 2e-15
218497000426	Pfam match to entry PF00013 KH, KH domain , score 28.3, E-value 1.1e-05
218497000427	Pfam match to entry PF00189 Ribosomal_S3_C, Ribosomal protein S3, C-terminal domain , score 178.0, E-value 1e-50
218497000428	PS00548 Ribosomal protein S3 signature.
218497000429	Ribosomal_L16_L10e: L16 is an essential protein in the large ribosomal subunit of bacteria, mitochondria, and chloroplasts. Large subunits that lack L16 are defective in peptidyl transferase activity, peptidyl-tRNA hydrolysis activity, association with...; Region: Ribosomal_L16_L10e; cd01433
218497000430	23S rRNA interface [nucleotide binding]; other site
218497000431	5S rRNA interface [nucleotide binding]; other site
218497000432	putative antibiotic binding site [chemical binding]; other site
218497000433	L25 interface [polypeptide binding]; other site
218497000434	L27 interface [polypeptide binding]; other site
218497000435	Pfam match to entry PF00252 Ribosomal_L16, Ribosomal protein L16 , score 269.5, E-value 2.9e-78
218497000436	PS00586 Ribosomal protein L16 signature 1.
218497000437	PS00701 Ribosomal protein L16 signature 2.
218497000438	Ribosomal L29 protein/HIP.  L29 is a protein of the large ribosomal Subunit. A homolog, called heparin/heparan sulfate interacting protein (HIP), has also been identified in mammals.  L29 is located on the surface of the large ribosomal subunit, where it...; Region: Ribosomal_L29_HIP; cd00427
218497000439	23S rRNA interface [nucleotide binding]; other site
218497000440	putative translocon interaction site; other site
218497000441	signal recognition particle (SRP54) interaction site; other site
218497000442	L23 interface [polypeptide binding]; other site
218497000443	trigger factor interaction site; other site
218497000444	Ribosomal protein S17; Region: Ribosomal_S17; cl00351
218497000445	Pfam match to entry PF00366 Ribosomal_S17, Ribosomal protein S17 , score 114.4, E-value 1.4e-31
218497000446	PS00056 Ribosomal protein S17 signature.
218497000447	Ribosomal protein L14p/L23e; Region: Ribosomal_L14; cl00328
218497000448	Pfam match to entry PF00238 Ribosomal_L14, Ribosomal protein L14p/L23e , score 271.2, E-value 8.8e-79
218497000449	PS00049 Ribosomal protein L14 signature.
218497000450	Ribosomal protein L24 [Translation, ribosomal structure and biogenesis]; Region: RplX; COG0198
218497000451	KOW motif; Region: KOW; cl00354
218497000452	Pfam match to entry PF00467 KOW, KOW motif , score 44.2, E-value 1.9e-10
218497000453	PS01108 Ribosomal protein L24 signature.
218497000454	50S ribosomal protein L5; Validated; Region: rplE; PRK00010
218497000455	Ribosomal protein L5; Region: Ribosomal_L5; pfam00281
218497000456	ribosomal L5P family C-terminus; Region: Ribosomal_L5_C; pfam00673
218497000457	Pfam match to entry PF00281 Ribosomal_L5, Ribosomal protein L5 , score 115.1, E-value 8.4e-32
218497000458	PS00358 Ribosomal protein L5 signature.
218497000459	Pfam match to entry PF00673 Ribosomal_L5_C, ribosomal L5P family C-terminus , score 107.9, E-value 1.3e-29
218497000460	Ribosomal protein S8; Region: Ribosomal_S8; cl00330
218497000461	Pfam match to entry PF00410 Ribosomal_S8, Ribosomal protein S8 , score 217.9, E-value 9.5e-63
218497000462	PS00053 Ribosomal protein S8 signature.
218497000463	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00294 Prenyl group binding site (CAAX box).
218497000464	50S ribosomal protein L6; Validated; Region: rplF; PRK05498
218497000465	Ribosomal protein L6; Region: Ribosomal_L6; pfam00347
218497000466	Ribosomal protein L6; Region: Ribosomal_L6; pfam00347
218497000467	Pfam match to entry PF00347 Ribosomal_L6, Ribosomal protein L6 , score 60.8, E-value 2e-15
218497000468	Pfam match to entry PF00347 Ribosomal_L6, Ribosomal protein L6 , score 108.4, E-value 8.8e-30
218497000469	PS00525 Ribosomal protein L6 signature 1.
218497000470	Ribosomal L18/L5e:  L18 (L5e) is a ribosomal protein found in the central protuberance (CP) of the large subunit. L18 binds 5S rRNA and induces a conformational change that stimulates the binding of L5 to 5S rRNA. Association of 5S rRNA with 23S rRNA...; Region: Ribosomal_L18_L5e; cd00432
218497000471	5S rRNA interface [nucleotide binding]; other site
218497000472	23S rRNA interface [nucleotide binding]; other site
218497000473	L5 interface [polypeptide binding]; other site
218497000474	Pfam match to entry PF00861 Ribosomal_L18p, Ribosomal L18p/L5e family , score 150.5, E-value 1.9e-42
218497000475	30S ribosomal protein S5; Validated; Region: rpsE; PRK00550
218497000476	Ribosomal protein S5, N-terminal domain; Region: Ribosomal_S5; pfam00333
218497000477	Ribosomal protein S5, C-terminal domain; Region: Ribosomal_S5_C; pfam03719
218497000478	Pfam match to entry PF00333 Ribosomal_S5, Ribosomal protein S5, N-terminal domain , score 132.3, E-value 5.7e-37
218497000479	PS00585 Ribosomal protein S5 signature.
218497000480	Pfam match to entry PF03719 Ribosomal_S5_C, Ribosomal protein S5, C-terminal domain , score 129.8, E-value 3.2e-36
218497000481	Ribosomal protein L18e/L15; Region: Ribosomal_L18e; cl12022
218497000482	Pfam match to entry PF01305 Ribosomal_L15, Ribosomal protein L15 amino terminal region , score 205.8, E-value 4.3e-59
218497000483	preprotein translocase subunit SecY; Reviewed; Region: secY; PRK09204
218497000484	SecY translocase; Region: SecY; pfam00344
218497000485	10 probable transmembrane helices predicted for CAB110 by TMHMM2.0 at aa 17-39, 74-96, 117-134, 161-183, 190-212, 232-254, 284-306, 326-345, 384-406 and 410-429
218497000486	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000487	Pfam match to entry PF00344 secY, eubacterial secY protein , score 635.8, E-value 1.5e-188
218497000488	PS00755 Protein secY signature 1.
218497000489	PS00756 Protein secY signature 2.
218497000490	PS00307 Legume lectins beta-chain signature.
218497000491	Ribosomal protein S13/S18; Region: Ribosomal_S13; cl00331
218497000492	Pfam match to entry PF00416 Ribosomal_S13, Ribosomal protein S13/S18 , score 178.5, E-value 7.2e-51
218497000493	PS00435 Peroxidases proximal heme-ligand signature.
218497000494	PS00646 Ribosomal protein S13 signature.
218497000495	Ribosomal protein S11; Region: Ribosomal_S11; cl00332
218497000496	Pfam match to entry PF00411 Ribosomal_S11, Ribosomal protein S11 , score 190.9, E-value 1.4e-54
218497000497	PS00054 Ribosomal protein S11 signature.
218497000498	DNA-directed RNA polymerase subunit alpha; Provisional; Region: PRK05182
218497000499	N-terminal domain of the Alpha subunit of Bacterial RNA polymerase; Region: RNAP_alpha_NTD; cd06928
218497000500	alphaNTD - beta interaction site [polypeptide binding]; other site
218497000501	alphaNTD homodimer interface [polypeptide binding]; other site
218497000502	alphaNTD - beta' interaction site [polypeptide binding]; other site
218497000503	Bacterial RNA polymerase, alpha chain C terminal domain; Region: RNA_pol_A_CTD; cl11613
218497000504	Pfam match to entry PF01000 RNA_pol_A_bac, Bacterial RNA polymerase, alpha chain, N terminal domain , score 360.1, E-value 1.6e-105
218497000505	Pfam match to entry PF03118 RNA_pol_A_CTD, Bacterial RNA polymerase, alpha chain C terminal domain , score 125.2, E-value 8.1e-35
218497000506	Ribosomal protein L17; Region: Ribosomal_L17; cl00356
218497000507	Pfam match to entry PF01196 Ribosomal_L17, Ribosomal protein L17 , score 248.3, E-value 6.9e-72
218497000508	PS01167 Ribosomal protein L17 signature.
218497000509	Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; Region: Gp_dh_N; cl15267
218497000510	glyceraldehyde-3-phosphate dehydrogenase, type I; Region: GAPDH-I; TIGR01534
218497000511	Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; Region: Gp_dh_C; pfam02800
218497000512	Pfam match to entry PF00044 gpdh, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain , score 319.8, E-value 2.1e-93
218497000513	PS00071 Glyceraldehyde 3-phosphate dehydrogenase active site.
218497000514	Pfam match to entry PF02800 gpdh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain , score 394.6, E-value 6.2e-116
218497000515	Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination.  HJR's occur in archaea, bacteria, and in the mitochondria of certain fungi, however this CD includes...; Region: RuvC_resolvase; cd00529
218497000516	active site
218497000517	putative DNA-binding cleft [nucleotide binding]; other site
218497000518	dimer interface [polypeptide binding]; other site
218497000519	Pfam match to entry PF02075 RuvC, Crossover junction endodeoxyribonuclease RuvC , score 260.4, E-value 1.6e-75
218497000520	Holliday junction DNA helicase RuvA; Reviewed; Region: ruvA; PRK00116
218497000521	RuvA N terminal domain; Region: RuvA_N; pfam01330
218497000522	RuvA, C-terminal domain; Region: RuvA_C; pfam07499
218497000523	Pfam match to entry PF01330 RuvA, RuvA N terminal domain , score 86.9, E-value 2.7e-23
218497000524	Pfam match to entry PF02904 RuvA_II, RuvA central domain II , score 136.9, E-value 2.4e-38
218497000525	Nucleoside diphosphate kinase Group I (NDPk_I)-like: NDP kinase domains are present in a large family of structurally and functionally conserved proteins from bacteria to humans that generally catalyze the transfer of gamma-phosphates of a nucleoside...; Region: NDPk_I; cd04413
218497000526	active site
218497000527	multimer interface [polypeptide binding]; other site
218497000528	Pfam match to entry PF00334 NDK, Nucleoside diphosphate kinase , score 253.5, E-value 1.9e-73
218497000529	PS00469 Nucleoside diphosphate kinases active site.
218497000530	Lipoate-protein ligase A [Coenzyme metabolism]; Region: LplA; COG0095
218497000531	Biotin/lipoate A/B protein ligase family; Region: BPL_LplA_LipB; cl14057
218497000532	Pfam match to entry PF03099 BPL_LipA_LipB, Biotin/lipoate A/B protein ligase , score 59.1, E-value 6.4e-15
218497000533	tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated; Region: PRK05192
218497000534	tRNA (uracil-5-)-methyltransferase Gid; Reviewed; Region: PRK05335; cl15440
218497000535	Pfam match to entry PF01134 GIDA, Glucose inhibited division protein A , score 1089.9, E-value 0
218497000536	PS01280 Glucose inhibited division protein A family signature 1.
218497000537	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000538	replicative DNA helicase; Provisional; Region: PRK06321
218497000539	DnaB-like helicase N terminal domain; Region: DnaB; pfam00772
218497000540	DnaB helicase C terminal domain. The hexameric helicase DnaB unwinds the DNA duplex at the  chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a...; Region: DnaB_C; cd00984
218497000541	Walker A motif; other site
218497000542	ATP binding site [chemical binding]; other site
218497000543	Walker B motif; other site
218497000544	DNA binding loops [nucleotide binding]
218497000545	Pfam match to entry PF03796 DnaB_C, DnaB-like helicase C terminal domain , score 406.5, E-value 1.7e-119
218497000546	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000547	Pfam match to entry PF00772 DnaB, DnaB-like helicase N terminal domain , score 122.8, E-value 4.1e-34
218497000548	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; cl00453
218497000549	Pfam match to entry PF01066 CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase , score 94.4, E-value 1.5e-25
218497000550	PS00379 CDP-alcohol phosphatidyltransferases signature.
218497000551	4 probable transmembrane helices predicted for CAB124 by TMHMM2.0 at aa 54-76, 86-108, 115-137 and 141-160
218497000552	TLC ATP/ADP transporter; Region: TLC; cl03940
218497000553	PS00430 TonB-dependent receptor proteins signature 1.
218497000554	Pfam match to entry PF03219 TLC, TLC ATP/ADP transporter , score 925.3, E-value 1.1e-275
218497000555	11 probable transmembrane helices predicted for CAB125 by TMHMM2.0 at aa 27-44, 64-86, 93-115, 149-171, 184-206, 221-243, 301-323, 343-360, 367-389, 399-418 and 485-507
218497000556	PS00659 Glycosyl hydrolases family 5 signature.
218497000557	Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad; Region: S49_Sppa_N_C; cd07023
218497000558	tandem repeat interface [polypeptide binding]; other site
218497000559	oligomer interface [polypeptide binding]; other site
218497000560	active site residues [active]
218497000561	Signal peptide predicted for CAB126 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.227 between residues 41 and 42
218497000562	Pfam match to entry PF01343 Peptidase_U7, Peptidase U7 , score 94.4, E-value 1.5e-25
218497000563	DNA polymerase I; Provisional; Region: PRK05755
218497000564	PIN domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: PIN_53EXO; cd09859
218497000565	active site
218497000566	metal binding site 1 [ion binding]; metal-binding site
218497000567	putative 5' ssDNA interaction site; other site
218497000568	metal binding site 3; metal-binding site
218497000569	metal binding site 2 [ion binding]; metal-binding site
218497000570	H3TH domain of the 5'-3' exonuclease of Taq DNA polymerase I and homologs; Region: H3TH_53EXO; cd09898
218497000571	putative DNA binding site [nucleotide binding]; other site
218497000572	putative metal binding site [ion binding]; other site
218497000573	inactive DEDDy 3'-5' exonuclease domain of Bacillus stearothermophilus DNA polymerase I and similar family-A DNA polymerases; Region: DNA_polA_I_Bacillus_like_exo; cd06140
218497000574	Polymerase I functions primarily to fill DNA gaps that arise during DNA repair, recombination and replication; Region: DNA_pol_A_pol_I_C; cd08637
218497000575	active site
218497000576	DNA binding site [nucleotide binding]
218497000577	catalytic site [active]
218497000578	Pfam match to entry PF02739 5_3_exonuc_N, 5'-3' exonuclease, N-terminal resolvase-like domain , score 258.1, E-value 7.5e-75
218497000579	Pfam match to entry PF01367 5_3_exonuclease, 5'-3' exonuclease, C-terminal SAM fold , score 143.5, E-value 2.4e-40
218497000580	Pfam match to entry PF00476 DNA_pol_A, DNA polymerase A , score 450.8, E-value 7.4e-133
218497000581	Dephospho-CoA kinase [Coenzyme metabolism]; Region: CoaE; COG0237
218497000582	Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis; Region: DPCK; cd02022
218497000583	CoA-binding site [chemical binding]; other site
218497000584	ATP-binding [chemical binding]; other site
218497000585	Pfam match to entry PF01121 CoaE, Dephospho-CoA kinase , score 85.3, E-value 8.1e-23
218497000586	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000587	transcription termination factor Rho; Provisional; Region: rho; PRK09376
218497000588	Rho termination factor, N-terminal domain; Region: Rho_N; cl06505
218497000589	Rho_CSD: Rho protein cold-shock domain (CSD). Rho protein is a transcription termination factor in most bacteria. In bacteria, there are two distinct mechanisms for mRNA transcription termination. In intrinsic termination, RNA polymerase and nascent mRNA...; Region: Rho_CSD; cd04459
218497000590	RNA binding site [nucleotide binding]; other site
218497000591	Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase. It is a homohexamer. Each monomer consists of an N-terminal domain of the OB fold, which is responsible for binding to cysteine rich nucleotides. This alignment is of the...; Region: rho_factor; cd01128
218497000592	multimer interface [polypeptide binding]; other site
218497000593	Walker A motif; other site
218497000594	ATP binding site [chemical binding]; other site
218497000595	Walker B motif; other site
218497000596	Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain , score 289.8, E-value 2.2e-84
218497000597	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000598	Phosphoribosyl transferase domain; Region: Pribosyltran; cl00309
218497000599	Pfam match to entry PF00156 Pribosyltran, Phosphoribosyl transferase domain , score 74.0, E-value 2.1e-19
218497000600	glucose-1-phosphate adenylyltransferase; Region: glgC; TIGR02091
218497000601	ADP-glucose pyrophosphorylase is involved in the biosynthesis of glycogen or starch; Region: ADP_Glucose_PP; cd02508
218497000602	ligand binding site; other site
218497000603	oligomer interface; other site
218497000604	Glucose-1-phosphate adenylyltransferase, C-terminal Left-handed parallel beta helix (LbH) domain: Glucose-1-phosphate adenylyltransferase is also known as ADP-glucose synthase or ADP-glucose pyrophosphorylase. It catalyzes the first committed and...; Region: LbH_G1P_AT_C; cd04651
218497000605	dimer interface [polypeptide binding]; other site
218497000606	N-terminal domain interface [polypeptide binding]; other site
218497000607	sulfate 1 binding site; other site
218497000608	Pfam match to entry PF00483 NTP_transferase, Nucleotidyl transferase , score 154.1, E-value 1.6e-43
218497000609	PS00809 ADP-glucose pyrophosphorylase signature 2.
218497000610	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 7.7, E-value 5
218497000611	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 13.3, E-value 0.39
218497000612	Calcineurin-like phosphoesterase; Region: Metallophos; pfam00149
218497000613	Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain; Region: MPP_DR1119; cd07393
218497000614	putative active site [active]
218497000615	putative metal binding site [ion binding]; other site
218497000616	Pfam match to entry PF00149 Metallophos, Calcineurin-like phosphoesterase , score 65.5, E-value 7.2e-17
218497000617	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
218497000618	S-adenosylmethionine binding site [chemical binding]; other site
218497000619	Pfam match to entry PF03602 Cons_hypoth95, Conserved hypothetical protein 95 , score 242.8, E-value 3.1e-70
218497000620	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000621	PS00092 N-6 Adenine-specific DNA methylases signature.
218497000622	Bacterial periplasmic substrate-binding proteins; Region: PBPb; smart00062
218497000623	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
218497000624	substrate binding pocket [chemical binding]; other site
218497000625	membrane-bound complex binding site; other site
218497000626	hinge residues; other site
218497000627	Signal peptide predicted for CAB135 by SignalP 2.0 HMM (Signal peptide probabilty 0.980) with cleavage site probability 0.471 between residues 24 and 25
218497000628	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000629	Pfam match to entry PF00497 SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 , score 77.2, E-value 2.2e-20
218497000630	ferrochelatase; Reviewed; Region: hemH; PRK00035
218497000631	Ferrochelatase, N-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is...; Region: Ferrochelatase_N; cd03411
218497000632	C-terminal domain interface [polypeptide binding]; other site
218497000633	active site
218497000634	Ferrochelatase, C-terminal domain: Ferrochelatase (protoheme ferrolyase or HemH) is the terminal enzyme of the heme biosynthetic pathway. It catalyzes the insertion of ferrous iron into the protoporphyrin IX ring yielding protoheme. This enzyme is...; Region: Ferrochelatase_C; cd00419
218497000635	active site
218497000636	N-terminal domain interface [polypeptide binding]; other site
218497000637	Pfam match to entry PF00762 Ferrochelatase, Ferrochelatase , score 410.5, E-value 1e-120
218497000638	PS00534 Ferrochelatase signature.
218497000639	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497000640	TPR motif; other site
218497000641	binding surface
218497000642	2 probable transmembrane helices predicted for CAB137 by TMHMM2.0 at aa 30-52 and 59-81
218497000643	2 probable transmembrane helices predicted for CAB138 by TMHMM2.0 at aa 36-58 and 78-100
218497000644	PS00043 Bacterial regulatory proteins, gntR family signature.
218497000645	Signal peptide predicted for CAB139 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.999 between residues 34 and 35
218497000646	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000647	The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like; cl01709
218497000648	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
218497000649	Pfam match to entry PF00496 SBP_bac_5, Bacterial extracellular solute-binding proteins, family 5 , score -23.3, E-value 1.6e-13
218497000650	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
218497000651	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
218497000652	dimer interface [polypeptide binding]; other site
218497000653	conserved gate region; other site
218497000654	ABC-ATPase subunit interface; other site
218497000655	5 probable transmembrane helices predicted for CAB141 by TMHMM2.0 at aa 13-35, 265-287, 294-316, 418-440 and 460-479
218497000656	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000657	Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component , score 35.6, E-value 7.5e-08
218497000658	ABC-type uncharacterized transport system, permease component [General function prediction only]; Region: COG4239
218497000659	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
218497000660	dimer interface [polypeptide binding]; other site
218497000661	conserved gate region; other site
218497000662	putative PBP binding loops; other site
218497000663	ABC-ATPase subunit interface; other site
218497000664	Signal peptide predicted for CAB142 by SignalP 2.0 HMM (Signal peptide probabilty 0.943) with cleavage site probability 0.773 between residues 42 and 43
218497000665	8 probable transmembrane helices predicted for CAB142 by TMHMM2.0 at aa 72-94, 101-123, 377-399, 411-433, 438-460, 489-511 and 545-567
218497000666	Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component , score 19.5, E-value 0.00073
218497000667	Methylated DNA-protein cysteine methyltransferase [DNA replication, recombination, and repair]; Region: Ada; COG0350
218497000668	The DNA repair protein O6-alkylguanine-DNA alkyltransferase (ATase; also known as AGT, AGAT and MGMT) reverses O6-alkylation DNA damage by transferring O6-alkyl adducts to an active site cysteine irreversibly, without inducing DNA strand breaks. ATases...; Region: ATase; cd06445
218497000669	DNA binding site [nucleotide binding]
218497000670	active site
218497000671	Pfam match to entry PF01035 Methyltransf_1, 6-O-methylguanine DNA methyltransferase, DNA binding domain , score 46.2, E-value 4.6e-11
218497000672	PS00374 Methylated-DNA--protein-cysteine methyltransferase active site.
218497000673	Predicted helix-turn-helix motif with score 1302.000, SD 3.62 at aa 114-135, sequence HTYGDIAQATDTHPRTVGAVCK
218497000674	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2849
218497000675	Signal peptide predicted for CAB144 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.467 between residues 23 and 24
218497000676	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000677	phenylalanyl-tRNA synthetase subunit beta; Reviewed; Region: pheT; PRK00629
218497000678	tRNA-binding-domain-containing prokaryotic phenylalanly tRNA synthetase (PheRS) beta chain.  PheRS aminoacylate phenylalanine transfer RNAs (tRNAphe). PheRSs belong structurally to class II aminoacyl tRNA synthetases (aaRSs) but, as they aminoacylate...; Region: tRNA_bind_bactPheRS; cd02796
218497000679	putative tRNA-binding site [nucleotide binding]; other site
218497000680	B3/4 domain; Region: B3_4; cl11458
218497000681	tRNA synthetase B5 domain; Region: B5; cl08394
218497000682	Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain. PheRS belongs to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure. While class II aaRSs generally aminoacylate the 3'-OH ribose of the appropriate tRNA,  PheRS is an...; Region: PheRS_beta_core; cd00769
218497000683	dimer interface [polypeptide binding]; other site
218497000684	motif 1; other site
218497000685	motif 3; other site
218497000686	motif 2; other site
218497000687	Ferredoxin-fold anticodon binding domain; Region: FDX-ACB; cl08386
218497000688	Pfam match to entry PF03147 FDX-ACB, Ferredoxin-fold anticodon binding domain , score 117.0, E-value 2.4e-32
218497000689	Pfam match to entry PF03484 B5, tRNA synthetase B5 domain , score 65.4, E-value 8e-17
218497000690	Pfam match to entry PF03483 B3_4, B3/4 domain , score 150.2, E-value 2.3e-42
218497000691	Pfam match to entry PF01588 tRNA_bind,  tRNA binding domain , score 116.4, E-value 3.5e-32
218497000692	Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function; Region: LysM; cd00118
218497000693	putative peptidoglycan binding site; other site
218497000694	Signal peptide predicted for CAB146 by SignalP 2.0 HMM (Signal peptide probabilty 0.871) with cleavage site probability 0.569 between residues 34 and 35
218497000695	Pfam match to entry PF01476 LysM, LysM domain , score 67.1, E-value 2.5e-17
218497000696	Domain of unknown function DUF37; Region: DUF37; cl00506
218497000697	Pfam match to entry PF01809 DUF37, Domain of unknown function DUF37 , score 128.3, E-value 9.1e-36
218497000698	Uncharacterised ACR, YagE family COG1723; Region: DUF155; cl00751
218497000699	Pfam match to entry PF02582 DUF155, Uncharacterized ACR, YagE family COG1723 , score 440.6, E-value 9e-130
218497000700	Signal peptide predicted for CAB149 by SignalP 2.0 HMM (Signal peptide probabilty 0.739) with cleavage site probability 0.575 between residues 23 and 24
218497000701	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000702	Recombination protein O N terminal; Region: RecO_N; pfam11967
218497000703	Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]; Region: RecO; COG1381
218497000704	Recombination protein O C terminal; Region: RecO_C; pfam02565
218497000705	Pfam match to entry PF02565 RecO, Recombination protein O , score 211.2, E-value 1e-60
218497000706	Type I restriction enzyme R protein N terminus (HSDR_N); Region: HSDR_N; cl14958
218497000707	RaiA ('ribosome-associated inhibitor A', also known as Protein Y (PY), YfiA, and SpotY,  is a stress-response protein that binds the ribosomal subunit interface and arrests translation by interfering with aminoacyl-tRNA binding to the ribosomal A site; Region: RaiA; cl00250
218497000708	Response regulator receiver domain; Region: Response_reg; pfam00072
218497000709	Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; Region: REC; cd00156
218497000710	active site
218497000711	phosphorylation site [posttranslational modification]
218497000712	intermolecular recognition site; other site
218497000713	dimerization interface [polypeptide binding]; other site
218497000714	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497000715	ATPases associated with a variety of cellular activities; Region: AAA; smart00382
218497000716	Walker A motif; other site
218497000717	ATP binding site [chemical binding]; other site
218497000718	Walker B motif; other site
218497000719	arginine finger; other site
218497000720	PS00688 Sigma-54 interaction domain C-terminal part signature.
218497000721	Pfam match to entry PF00158 Sigma54_activat, Sigma-54 interaction domain , score 423.3, E-value 1.5e-124
218497000722	Pfam match to entry PF00072 response_reg, Response regulator receiver domain , score 116.2, E-value 4.1e-32
218497000723	Chromosome segregation ATPases [Cell division and chromosome partitioning]; Region: Smc; COG1196
218497000724	chromosome segregation protein SMC, common bacterial type; Region: SMC_prok_B; TIGR02168
218497000725	2 probable transmembrane helices predicted for CAB154 by TMHMM2.0 at aa 48-70 and 75-97
218497000726	Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms]; Region: NtrB; COG3852
218497000727	PAS domain; PAS motifs appear in archaea, eubacteria and eukarya. Probably the most surprising identification of a PAS domain was that in EAG-like K+-channels. PAS domains have been found to bind ligands, and to act as sensors for light and oxygen in...; Region: PAS; cl02459
218497000728	Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via...; Region: HisKA; cd00082
218497000729	dimer interface [polypeptide binding]; other site
218497000730	phosphorylation site [posttranslational modification]
218497000731	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
218497000732	ATP binding site [chemical binding]; other site
218497000733	Mg2+ binding site [ion binding]; other site
218497000734	G-X-G motif; other site
218497000735	Pfam match to entry PF02518 HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase , score 78.4, E-value 9.7e-21
218497000736	Pfam match to entry PF00512 HisKA, His Kinase A (phosphoacceptor) domain , score 71.6, E-value 1.1e-18
218497000737	Pfam match to entry PF00989 PAS, PAS domain , score 23.1, E-value 5.9e-06
218497000738	haloacid dehalogenase-like hydrolase; Region: Hydrolase; pfam00702
218497000739	Haloacid dehalogenase-like hydrolases. The haloacid dehalogenase-like (HAD) superfamily includes L-2-haloacid dehalogenase, epoxide hydrolase, phosphoserine phosphatase, phosphomannomutase, phosphoglycolate phosphatase, P-type ATPase, and many others; Region: HAD_like; cd01427
218497000740	motif II; other site
218497000741	Pfam match to entry PF00702 Hydrolase, haloacid dehalogenase-like hydrolase , score 82.8, E-value 4.5e-22
218497000742	tRNA pseudouridine synthase A; Validated; Region: truA; PRK00021
218497000743	PseudoU_synth_EcTruA: Pseudouridine synthase, Escherichia coli TruA like. This group consists of eukaryotic and bacterial pseudouridine synthases similar to E.  coli TruA, Pseudomonas aeruginosa truA and human pseudouridine synthase-like 1 (PUSL1); Region: PseudoU_synth_EcTruA; cd02570
218497000744	dimerization interface 3.5A [polypeptide binding]; other site
218497000745	active site
218497000746	Pfam match to entry PF01416 PseudoU_synth_1, tRNA pseudouridine synthase , score 110.8, E-value 1.7e-30
218497000747	Pfam match to entry PF01416 PseudoU_synth_1, tRNA pseudouridine synthase , score 105.6, E-value 6.4e-29
218497000748	CDP-ME synthetase is involved in mevalonate-independent isoprenoid production; Region: CDP-ME_synthetase; cd02516
218497000749	substrate binding site; other site
218497000750	dimer interface; other site
218497000751	Pfam match to entry PF01128 IspD, Uncharacterized protein family UPF0007 , score 102.7, E-value 4.7e-28
218497000752	Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain; Region: MPP_YkuE_C; cd07385
218497000753	putative active site [active]
218497000754	putative metal binding site [ion binding]; other site
218497000755	Pfam match to entry PF00149 Metallophos, Calcineurin-like phosphoesterase , score 75.6, E-value 6.9e-20
218497000756	Signal peptide predicted for CAB161 by SignalP 2.0 HMM (Signal peptide probabilty 0.814) with cleavage site probability 0.531 between residues 20 and 21
218497000757	SWIB/MDM2 domain; Region: SWIB; cl02489
218497000758	Pfam match to entry PF02201 SWIB, BAF60b domain of the SWIB complex , score 135.2, E-value 7.8e-38
218497000759	peptide chain release factor 2; Validated; Region: prfB; PRK00578
218497000760	RF-1 domain; Region: RF-1; cl02875
218497000761	RF-1 domain; Region: RF-1; cl02875
218497000762	PF-2 carries a uga in-frame termination codon after leu-23 which is suppressed providing a mechanism for the protein to regulate its own production
218497000763	Pfam match to entry PF03462 PCRF, PCRF domain , score 190.7, E-value 1.5e-54
218497000764	Pfam match to entry PF00472 RF-1, Peptidyl-tRNA hydrolase domain , score 244.8, E-value 7.7e-71
218497000765	PS00745 Prokaryotic-type class I peptide chain release factors signature.
218497000766	N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl00357
218497000767	Pfam match to entry PF00583 Acetyltransf, Acetyltransferase (GNAT) family , score 74.6, E-value 1.3e-19
218497000768	Similar to Chlamydia pneumoniae hypothetical protein cpn0574 or cp0175 SWALL:Q9Z7X9 (EMBL:AE001642) (184 aa) fasta scores: E(): 4.2e-39, 60% id in 185 aa. No other database matches. Possible pseudogene arising from two frameshift mutations.;conserved hypothetical protein (pseudogene)
218497000769	Domain of unknown function DUF28; Region: DUF28; cl00361
218497000770	Pfam match to entry PF01709 DUF28, Domain of unknown function DUF28 , score 260.4, E-value 1.6e-75
218497000771	Domain of Unknown Function (DUF1547); Region: DUF1547; pfam07577
218497000772	Domain of Unknown Function (DUF1547); Region: DUF1547; pfam07577
218497000773	Domain of Unknown Function (DUF1547); Region: DUF1547; pfam07577
218497000774	ribonuclease E; Reviewed; Region: rne; PRK10811
218497000775	UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall. The reaction is phosphoenolpyruvate + UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555
218497000776	3-phosphoshikimate 1-carboxyvinyltransferase; Region: aroA; TIGR01356
218497000777	hinge; other site
218497000778	active site
218497000779	Pfam match to entry PF00275 EPSP_syntase, EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) , score 457.5, E-value 7.3e-135
218497000780	Arginyl tRNA synthetase N terminal domain; Region: Arg_tRNA_synt_N; cl04104
218497000781	arginine-tRNA ligase; Region: PLN02286
218497000782	catalytic core domain of arginyl-tRNA synthetases; Region: ArgRS_core; cd00671
218497000783	active site
218497000784	HIGH motif; other site
218497000785	KMSK motif region; other site
218497000786	Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains; Region: Anticodon_Ia_like; cl12020
218497000787	tRNA binding surface [nucleotide binding]; other site
218497000788	anticodon binding site; other site
218497000789	Pfam match to entry PF00750 tRNA-synt_1d, tRNA synthetases class I (R) , score 365.0, E-value 5e-107
218497000790	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
218497000791	Pfam match to entry PF03485 N-Arg, Arginyl tRNA synthetase N terminal domain , score 100.4, E-value 2.3e-27
218497000792	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
218497000793	putative acyl-acceptor binding pocket; other site
218497000794	Pfam match to entry PF01553 Acyltransferase, Acyltransferase , score 118.8, E-value 6.6e-33
218497000795	8 x poly G tract
218497000796	cytidylate kinase; Provisional; Region: cmk; PRK00023
218497000797	Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor; Region: CMPK; cd02020
218497000798	CMP-binding site; other site
218497000799	The sites determining sugar specificity; other site
218497000800	Pfam match to entry PF02224 Cytidylate_kin, Cytidylate kinase , score 265.1, E-value 6.2e-77
218497000801	PS00092 N-6 Adenine-specific DNA methylases signature.
218497000802	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000803	Cytidylyltransferase family; Region: CTP_transf_1; cl00347
218497000804	Pfam match to entry PF01148 CTP_transf_1, Phosphatidate cytidylyltransferase , score 166.7, E-value 2.5e-47
218497000805	8 probable transmembrane helices predicted for CAB172 by TMHMM2.0 at aa 43-62, 69-91, 96-118, 131-153, 163-185, 205-227, 231-253 and 274-296
218497000806	Signal peptide predicted for CAB172 by SignalP 2.0 HMM (Signal peptide probabilty 0.986) with cleavage site probability 0.526 between residues 44 and 45
218497000807	Undecaprenyl pyrophosphate synthase [Lipid metabolism]; Region: UppS; COG0020
218497000808	Cis (Z)-Isoprenyl Diphosphate Synthases (cis-IPPS); homodimers which catalyze the successive 1'-4 condensation of the isopentenyl diphosphate (IPP) molecule to trans,trans-farnesyl diphosphate (FPP) or to cis,trans-FPP to form long-chain polyprenyl...; Region: CIS_IPPS; cl00230
218497000809	catalytic residue [active]
218497000810	putative FPP diphosphate  binding site; other site
218497000811	putative FPP binding hydrophobic cleft; other site
218497000812	dimer interface [polypeptide binding]; other site
218497000813	putative IPP diphosphate binding site; other site
218497000814	Pfam match to entry PF01255 UPP_synthetase, undecaprenyl diphosphate synthase , score 291.5, E-value 6.6e-85
218497000815	PS01066 Undecaprenyl pyrophosphate synthetase signature.
218497000816	2 probable transmembrane helices predicted for CAB174 by TMHMM2.0 at aa 38-60 and 67-89
218497000817	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00294 Prenyl group binding site (CAAX box).
218497000818	bifunctional preprotein translocase subunit SecD/SecF; Reviewed; Region: PRK12911
218497000819	Protein export membrane protein; Region: SecD_SecF; cl14618
218497000820	Protein export membrane protein; Region: SecD_SecF; cl14618
218497000821	12 probable transmembrane helices predicted for CAB175 by TMHMM2.0 at aa 9-31, 912-931, 933-955, 960-982, 1008-1027, 1037-1059, 1091-1113, 1237-1256, 1263-1285, 1295-1314, 1345-1367 and 1372-1394
218497000822	PS00030 Eukaryotic  RNA-binding region RNP-1 signature.
218497000823	PS00037 Myb DNA-binding domain repeat signature 1.
218497000824	Pfam match to entry PF02355 SecD_SecF, Protein export membrane protein , score 405.2, E-value 4.1e-119
218497000825	single-stranded-DNA-specific exonuclease RecJ; Region: recJ; TIGR00644
218497000826	DHH family; Region: DHH; pfam01368
218497000827	DHHA1 domain; Region: DHHA1; pfam02272
218497000828	Pfam match to entry PF01368 DHH, DHH family , score 182.4, E-value 4.9e-52
218497000829	Pfam match to entry PF02272 DHHA1, DHHA1 domain , score 61.5, E-value 1.2e-15
218497000830	Chlamydia CHLPS protein (DUF818); Region: DUF818; pfam05677
218497000831	1 probable transmembrane helix predicted for CAB177 by TMHMM2.0 at aa 50-72
218497000832	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
218497000833	Helix-Turn-Helix DNA binding domain of transcription regulators from the MerR superfamily; Region: HTH_MerR-SF; cl02600
218497000834	Predicted helix-turn-helix motif with score 1177.000, SD 3.20 at aa 30-119, sequence VSITQAAKLHNVTRQAIYVAIKQKKLKASKTTRWEIDLKDLEDYKRNRYSRKKSLYQ GELLFDNDKGCYSVNQVADMLGIPVQKVYYATR
218497000835	glutamyl-tRNA synthetase; Reviewed; Region: gltX; PRK01406
218497000836	catalytic core domain of discriminating glutamyl-tRNA synthetase; Region: GluRS_core; cd00808
218497000837	HIGH motif; other site
218497000838	catalytic core domain of discriminating glutamyl-tRNA synthetase; Region: GluRS_core; cd00808
218497000839	active site
218497000840	KMSKS motif; other site
218497000841	Pfam match to entry PF00749 tRNA-synt_1c, tRNA synthetases class I (E and Q), catalytic domain , score 531.7, E-value 3.3e-157
218497000842	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
218497000843	Chlamydia cysteine-rich outer membrane protein 3; Region: Chlam_OMP3; pfam03503
218497000844	Signal peptide predicted for CAB180 by SignalP 2.0 HMM (Signal peptide probabilty 0.682) with cleavage site probability 0.524 between residues 16 and 17
218497000845	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497000846	Pfam match to entry PF03503 Chlam_OMP3, Chlamydia cysteine-rich outer membrane protein 3 , score 106.2, E-value 4.3e-29
218497000847	Chlamydia cysteine-rich outer membrane protein 6; Region: Chlam_OMP6; pfam03504
218497000848	Fibronectin type III-like domain; Region: Fn3-like; cl15273
218497000849	Fibronectin type III-like domain; Region: Fn3-like; cl15273
218497000850	Signal peptide predicted for CAB181 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.640 between residues 22 and 23
218497000851	Pfam match to entry PF03504 Chlam_OMP6, Chlamydia cysteine-rich outer membrane protein 6 , score 268.6, E-value 5.3e-78
218497000852	Chlamydia 15 kDa cysteine-rich outer membrane protein (CRPA); Region: CRPA; pfam05745
218497000853	2 probable transmembrane helices predicted for CAB182 by TMHMM2.0 at aa 61-83 and 90-112
218497000854	Opioid growth factor receptor (OGFr) conserved region; Region: OGFr_N; pfam04664
218497000855	Periplasmic protease [Cell envelope biogenesis, outer membrane]; Region: Prc; COG0793
218497000856	PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts. May be responsible for...; Region: PDZ_CTP_protease; cd00988
218497000857	protein binding site [polypeptide binding]; other site
218497000858	C-terminal processing peptidase; serine protease family S41; Region: Peptidase_S41_CPP; cd07560
218497000859	Catalytic dyad [active]
218497000860	Pfam match to entry PF00595 PDZ, PDZ domain (Also known as DHR or GLGF) , score 44.8, E-value 1.2e-10
218497000861	Signal peptide predicted for CAB183 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.999 between residues 21 and 22
218497000862	2 probable transmembrane helices predicted for CAB184 by TMHMM2.0 at aa 25-47 and 57-79
218497000863	ribokinase/pfkB superfamily: Kinases that accept a wide variety of substrates, including carbohydrates and aromatic small molecules, all are phosphorylated at a hydroxyl group. The superfamily includes ribokinase, fructokinase, ketohexokinase; Region: ribokinase_pfkB_like; cl00192
218497000864	Signal peptide predicted for CAB185 by SignalP 2.0 HMM (Signal peptide probabilty 0.970) with cleavage site probability 0.334 between residues 24 and 25
218497000865	S12-like family, 30S ribosomal protein S12 subfamily; S12 is located at the interface of the large and small ribosomal subunits of prokaryotes, chloroplasts and mitochondria, where it plays an important role in both tRNA and ribosomal subunit...; Region: Ribosomal_S12; cd03368
218497000866	S17 interaction site [polypeptide binding]; other site
218497000867	S8 interaction site; other site
218497000868	16S rRNA interaction site [nucleotide binding]; other site
218497000869	streptomycin interaction site [chemical binding]; other site
218497000870	23S rRNA interaction site [nucleotide binding]; other site
218497000871	aminoacyl-tRNA interaction site (A-site) [nucleotide binding]; other site
218497000872	Pfam match to entry PF00164 Ribosomal_S12, Ribosomal protein S12 , score 263.1, E-value 2.4e-76
218497000873	PS00055 Ribosomal protein S12 signature.
218497000874	Ribosomal protein S7p/S5e; Region: Ribosomal_S7; cl00313
218497000875	Pfam match to entry PF00177 Ribosomal_S7, Ribosomal protein S7p/S5e , score 323.3, E-value 1.8e-94
218497000876	PS00052 Ribosomal protein S7 signature.
218497000877	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000878	elongation factor G; Reviewed; Region: PRK12739
218497000879	Elongation factor G (EF-G) subfamily. Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so...; Region: EF-G; cd01886
218497000880	G1 box; other site
218497000881	putative GEF interaction site [polypeptide binding]; other site
218497000882	GTP/Mg2+ binding site [chemical binding]; other site
218497000883	Switch I region; other site
218497000884	G2 box; other site
218497000885	G3 box; other site
218497000886	Switch II region; other site
218497000887	G4 box; other site
218497000888	G5 box; other site
218497000889	EFG_mtEFG_II: this subfamily represents the domain II of elongation factor G (EF-G) in bacteria and, the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2)_like proteins found in eukaryotes. During the process of peptide synthesis...; Region: EFG_mtEFG_II; cd04088
218497000890	EFG_mtEFG1_IV: domains similar to domain IV of the bacterial translational elongation factor (EF) EF-G. Included in this group is a domain of mitochondrial Elongation factor G1 (mtEFG1) proteins homologous to domain IV of EF-G. Eukaryotic cells harbor 2...; Region: EFG_mtEFG1_IV; cd01434
218497000891	EFG_mtEFG_C: domains similar to the C-terminal domain of the bacterial translational elongation factor (EF) EF-G.  Included in this group is the C-terminus of mitochondrial Elongation factor G1 (mtEFG1) and G2 (mtEFG2) proteins. Eukaryotic cells harbor 2...; Region: EFG_mtEFG_C; cd03713
218497000892	Pfam match to entry PF00009 GTP_EFTU, Elongation factor Tu GTP binding domain , score 372.7, E-value 2.5e-109
218497000893	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000894	PS00301 GTP-binding elongation factors signature.
218497000895	Pfam match to entry PF03144 GTP_EFTU_D2, Elongation factor Tu domain 2 , score 91.2, E-value 1.4e-24
218497000896	Pfam match to entry PF03764 EFG_IV, Elongation factor G, domain IV , score 230.6, E-value 1.5e-66
218497000897	Pfam match to entry PF00679 EFG_C, Elongation factor G C-terminus , score 147.7, E-value 1.3e-41
218497000898	Ribosomal protein S10p/S20e; Region: Ribosomal_S10; cl00314
218497000899	Pfam match to entry PF00338 Ribosomal_S10, Ribosomal protein S10p/S20e , score 199.5, E-value 3.4e-57
218497000900	PS00361 Ribosomal protein S10 signature.
218497000901	Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport...; Region: FNR_like; cl06868
218497000902	FAD binding pocket [chemical binding]; other site
218497000903	conserved FAD binding motif [chemical binding]; other site
218497000904	phosphate binding motif [ion binding]; other site
218497000905	beta-alpha-beta structure motif; other site
218497000906	NAD binding pocket [chemical binding]; other site
218497000907	Pfam match to entry PF00667 FAD_binding_1, FAD binding domain , score -1.7, E-value 1.2e-07
218497000908	Pfam match to entry PF00175 NAD_binding_1, Oxidoreductase NAD-binding domain , score 59.3, E-value 5.5e-15
218497000909	MECDP_synthase (2-C-methyl-D-erythritol-2,4-cyclodiphosphate synthase), encoded by the ispF gene, catalyzes the formation of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate (MEC) in the non-mevalonate deoxyxylulose (DOXP) pathway for isoprenoid biosynthesis; Region: MECDP_synthase; cd00554
218497000910	homotrimer interaction site [polypeptide binding]; other site
218497000911	zinc binding site [ion binding]; other site
218497000912	CDP-binding sites; other site
218497000913	Pfam match to entry PF02542 YgbB, YgbB family , score 272.2, E-value 4.4e-79
218497000914	Ribosomal prokaryotic L21 protein; Region: Ribosomal_L21p; cl00382
218497000915	Pfam match to entry PF00829 Ribosomal_L21p, Ribosomal prokaryotic L21 protein , score 138.9, E-value 5.9e-39
218497000916	Ribosomal L27 protein; Region: Ribosomal_L27; cl00359
218497000917	Pfam match to entry PF01016 Ribosomal_L27, Ribosomal L27 protein , score 144.4, E-value 1.3e-40
218497000918	GTPase CgtA; Reviewed; Region: obgE; PRK12299
218497000919	GTP1/OBG; Region: GTP1_OBG; pfam01018
218497000920	Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins...; Region: Obg; cd01898
218497000921	G1 box; other site
218497000922	GTP/Mg2+ binding site [chemical binding]; other site
218497000923	Switch I region; other site
218497000924	G2 box; other site
218497000925	G3 box; other site
218497000926	Switch II region; other site
218497000927	G4 box; other site
218497000928	G5 box; other site
218497000929	Pfam match to entry PF01018 GTP1_OBG, GTP1/OBG family , score 282.5, E-value 3.6e-82
218497000930	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000931	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
218497000932	dimer interface [polypeptide binding]; other site
218497000933	putative PBP binding regions; other site
218497000934	ABC-ATPase subunit  interface; other site
218497000935	Pfam match to entry PF00950 ABC-3, ABC 3 transport family , score 172.9, E-value 3.5e-49
218497000936	7 probable transmembrane helices predicted for CAB195 by TMHMM2.0 at aa 39-61, 71-90, 99-121, 141-163, 183-205, 225-247 and 254-271
218497000937	Signal peptide predicted for CAB195 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.428 between residues 28 and 29
218497000938	ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of...; Region: ABC_Metallic_Cations; cd03235
218497000939	ABC-type uncharacterized transport system, ATPase component [General function prediction only]; Region: COG4619
218497000940	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 160.1, E-value 2.5e-45
218497000941	PS00211 ABC transporters family signature.
218497000942	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000943	Metal binding protein ZntC.  These proteins are predicted to function as initial receptors in ABC transport of metal ions.  They belong to the TroA superfamily of helical backbone metal receptor proteins that share a distinct fold and ligand binding...; Region: ZntC; cd01018
218497000944	Periplasmic solute binding protein family; Region: SBP_bac_9; pfam01297
218497000945	putative metal binding residues [ion binding]; other site
218497000946	Pfam match to entry PF01297 SBP_bac_9, Periplasmic solute binding protein family , score 321.0, E-value 8.7e-94
218497000947	Signal peptide predicted for CAB197 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.988 between residues 19 and 20
218497000948	Thiamine monophosphate synthase (TMP synthase)/TenI. TMP synthase catalyzes an important step in the thiamine biosynthesis pathway, the substitution of the pyrophosphate of 2-methyl-4-amino-5- hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-; Region: TMP_TenI; cd00564
218497000949	thiamine phosphate binding site [chemical binding]; other site
218497000950	active site
218497000951	pyrophosphate binding site [ion binding]; other site
218497000952	Pfam match to entry PF02581 TMP-TENI, Thiamine monophosphate synthase/TENI , score 150.0, E-value 2.6e-42
218497000953	4-methyl-5-beta-hydroxyethylthiazole (Thz) kinase catalyzes the phosphorylation of the hydroxylgroup of Thz. A reaction that allows cells to recycle Thz into the thiamine biosynthesis pathway, as an alternative to its synthesis from cysteine, tyrosine...; Region: THZ_kinase; cd01170
218497000954	substrate binding site [chemical binding]; other site
218497000955	multimerization interface [polypeptide binding]; other site
218497000956	ATP binding site [chemical binding]; other site
218497000957	Pfam match to entry PF02110 HK, Hydroxyethylthiazole kinase , score 230.9, E-value 1.2e-66
218497000958	adhesin; Provisional; Region: PRK09752
218497000959	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497000960	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497000961	PS00017 ATP/GTP-binding site motif A (P-loop).
218497000962	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score -87.1, E-value 4.4e-06
218497000963	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 26.3, E-value 1.1e-07
218497000964	Signal peptide predicted for CAB200 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.995 between residues 21 and 22
218497000965	adhesin; Provisional; Region: PRK09752
218497000966	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497000967	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497000968	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497000969	Pfam match to entry PF03797 Autotransporter, Autotransporter beta-domain , score -6.7, E-value 0.00059
218497000970	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 30.3, E-value 9.8e-11
218497000971	Signal peptide predicted for CAB201 by SignalP 2.0 HMM (Signal peptide probabilty 0.991) with cleavage site probability 0.536 between residues 23 and 24
218497000972	YtxH-like protein; Region: YtxH; cl02079
218497000973	1 probable transmembrane helix predicted for CAB202 by TMHMM2.0 at aa 21-43
218497000974	Signal peptide predicted for CAB202 by SignalP 2.0 HMM (Signal peptide probabilty 0.970) with cleavage site probability 0.413 between residues 40 and 41
218497000975	bifunctional preprotein translocase subunit SecD/SecF; Provisional; Region: PRK14726
218497000976	Sodium:alanine symporter family; Region: Na_Ala_symp; cl00548
218497000977	Pfam match to entry PF01235 Na_Ala_symp, Sodium:alanine symporter family , score 18.7, E-value 4.6e-13
218497000978	11 probable transmembrane helices predicted for CAB204 by TMHMM2.0 at aa 15-33, 69-91, 101-123, 150-172, 182-199, 211-230, 240-262, 302-324, 351-372, 379-401 and 406-428
218497000979	PS01186 EGF-like domain signature 2.
218497000980	Signal peptidase (SPase) II; Region: Peptidase_A8; cl00458
218497000981	lipoprotein signal peptidase; Provisional; Region: PRK14787
218497000982	Pfam match to entry PF01252 Peptidase_A8, Signal peptidase (SPase) II , score 44.0, E-value 5.8e-13
218497000983	3 probable transmembrane helices predicted for CAB205 by TMHMM2.0 at aa 44-63, 70-92 and 107-129
218497000984	Prokaryotic dksA/traR C4-type zinc finger; Region: zf-dskA_traR; cl00755
218497000985	Pfam match to entry PF01258 zf_dskA_traR, Prokaryotic dksA/traR C4-type zinc finger , score 33.4, E-value 3.4e-07
218497000986	transcriptional regulator NrdR; Validated; Region: nrdR; PRK00464
218497000987	ATP cone domain; Region: ATP-cone; pfam03477
218497000988	Pfam match to entry PF03477 ATP-cone, ATP cone domain , score 108.7, E-value 7.3e-30
218497000989	riboflavin synthase subunit alpha; Provisional; Region: PRK09289
218497000990	Lumazine binding domain; Region: Lum_binding; pfam00677
218497000991	Lumazine binding domain; Region: Lum_binding; pfam00677
218497000992	Pfam match to entry PF00677 Lum_binding, Lumazine binding domain , score 90.2, E-value 2.6e-24
218497000993	Pfam match to entry PF00677 Lum_binding, Lumazine binding domain , score 103.0, E-value 3.7e-28
218497000994	PS00693 Riboflavin synthase alpha chain family signature.
218497000995	Predicted SAM-dependent methyltransferases [General function prediction only]; Region: COG1092
218497000996	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
218497000997	S-adenosylmethionine binding site [chemical binding]; other site
218497000998	rRNA methylases [Translation, ribosomal structure and biogenesis]; Region: SpoU; COG0566
218497000999	RNA 2'-O ribose methyltransferase substrate binding; Region: SpoU_sub_bind; cl06870
218497001000	SpoU rRNA Methylase family; Region: SpoU_methylase; cl00362
218497001001	Pfam match to entry PF00588 SpoU_methylase, SpoU rRNA Methylase , score 93.9, E-value 2.1e-25
218497001002	tetraacyldisaccharide 4'-kinase; Region: lpxK; TIGR00682
218497001003	Tetraacyldisaccharide-1-P 4'-kinase; Region: LpxK; cl03652
218497001004	Pfam match to entry PF02606 LpxK, Tetraacyldisaccharide-1-P 4'-kinase , score 501.1, E-value 5.5e-148
218497001005	1 probable transmembrane helix predicted for CAB211 by TMHMM2.0 at aa 24-46
218497001006	PS00136 Serine proteases, subtilase, aspartic acid active site.
218497001007	Sodium:dicarboxylate symporter family; Region: SDF; cl00573
218497001008	Pfam match to entry PF00375 SDF, Sodium:dicarboxylate symporter family , score 388.4, E-value 4.5e-114
218497001009	8 probable transmembrane helices predicted for CAB212 by TMHMM2.0 at aa 7-21, 36-58, 71-93, 135-157, 177-199, 214-233, 312-334 and 344-366
218497001010	branched-chain alpha-keto acid dehydrogenase subunit E2; Reviewed; Region: PRK11856
218497001011	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
218497001012	E3 interaction surface; other site
218497001013	lipoyl attachment site [posttranslational modification]; other site
218497001014	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; cl02008
218497001015	Pfam match to entry PF00364 biotin_lipoyl, Biotin-requiring enzyme , score 77.5, E-value 1.8e-20
218497001016	PS00189 2-oxo acid dehydrogenases acyltransferase component lipoyl binding site.
218497001017	Pfam match to entry PF02817 e3_binding, e3 binding domain , score 48.4, E-value 1e-11
218497001018	Pfam match to entry PF00198 2-oxoacid_dh, 2-oxo acid dehydrogenases acyltransferase (catalytic domain) , score 368.1, E-value 6e-108
218497001019	KpsF/GutQ family protein; Region: kpsF; TIGR00393
218497001020	KpsF-like protein. KpsF is an arabinose-5-phosphate isomerase which contains SIS (Sugar ISomerase) domains. SIS domains are found in many phosphosugar isomerases and phosphosugar binding proteins. KpsF catalyzes the reversible reaction of ribulose...; Region: SIS_Kpsf; cd05014
218497001021	putative active site [active]
218497001022	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein.  These APIs catalyze the conversion of the pentose pathway...; Region: CBS_pair_KpsF_GutQ_assoc; cd04604
218497001023	Pfam match to entry PF01380 SIS, SIS domain , score 91.5, E-value 1.1e-24
218497001024	Pfam match to entry PF00571 CBS, CBS domain , score 47.0, E-value 2.8e-11
218497001025	Pfam match to entry PF00571 CBS, CBS domain , score 29.0, E-value 7e-06
218497001026	Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]; Region: COG1579
218497001027	Putative zinc ribbon domain; Region: DUF164; pfam02591
218497001028	Pfam match to entry PF02591 DUF164, Uncharacterized ACR, COG1579 , score 376.6, E-value 1.6e-110
218497001029	PS00190 Cytochrome c family heme-binding site signature.
218497001030	Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly...; Region: Macro; cl00019
218497001031	2 probable transmembrane helices predicted for CAB217 by TMHMM2.0 at aa 37-59 and 63-85
218497001032	2 probable transmembrane helices predicted for CAB218 by TMHMM2.0 at aa 32-54 and 58-80
218497001033	Uroporphyrinogen-III synthase (HemD) catalyzes the asymmetrical cyclization of tetrapyrrole (linear) to uroporphyrinogen-III, the fourth step in the biosynthesis of heme. This ubiquitous enzyme is present in eukaryotes, bacteria and archaea. Mutations in...; Region: HemD; cd06578
218497001034	active site
218497001035	Pfam match to entry PF02602 HEM4, Uroporphyrinogen-III synthase HemD , score 96.5, E-value 3.3e-26
218497001036	serine hydroxymethyltransferase; Provisional; Region: PRK13580
218497001037	Serine-glycine hydroxymethyltransferase (SHMT). This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). SHMT carries out interconversion of serine and glycine; it catalyzes the transfer of hydroxymethyl...; Region: SHMT; cd00378
218497001038	dimer interface [polypeptide binding]; other site
218497001039	glycine-pyridoxal phosphate binding site [chemical binding]; other site
218497001040	active site
218497001041	folate binding site [chemical binding]; other site
218497001042	Pfam match to entry PF00464 SHMT, Serine hydroxymethyltransferase , score 450.3, E-value 1.1e-132
218497001043	PS00096 Serine hydroxymethyltransferase pyridoxal-phosphate attachment site.
218497001044	Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease; Region: S14_ClpP_2; cd07017
218497001045	oligomer interface [polypeptide binding]; other site
218497001046	active site residues [active]
218497001047	Pfam match to entry PF00574 CLP_protease, Clp protease , score 207.3, E-value 1.5e-59
218497001048	PS00382 Endopeptidase Clp histidine active site.
218497001049	diaminopimelate epimerase; Region: DapF; TIGR00652
218497001050	Diaminopimelate epimerase; Region: DAP_epimerase; cl14668
218497001051	Diaminopimelate epimerase; Region: DAP_epimerase; cl14668
218497001052	Pfam match to entry PF01678 DAP_epimerase, Diaminopimelate epimerase , score 9.4, E-value 7.9e-06
218497001053	Pfam match to entry PF01678 DAP_epimerase, Diaminopimelate epimerase , score 57.3, E-value 2.2e-14
218497001054	Uncharacterised protein family (UPF0158); Region: UPF0158; pfam03682
218497001055	Pfam match to entry PF03682 UPF0158, Uncharacterised protein family (UPF0158) , score 373.8, E-value 1.2e-109
218497001056	Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]; Region: UbiE; COG2226
218497001057	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
218497001058	S-adenosylmethionine binding site [chemical binding]; other site
218497001059	Pfam match to entry PF01209 Ubie_methyltran, ubiE/COQ5 methyltransferase , score 79.0, E-value 6.5e-21
218497001060	Tripartite tricarboxylate transporter family receptor; Region: TctC; cl15260
218497001061	Predicted periplasmic solute-binding protein [General function prediction only]; Region: COG1427
218497001062	Pfam match to entry PF02621 DUF178, Uncharacterized ACR, COG1427 , score 337.2, E-value 1.2e-98
218497001063	hypothetical protein; Provisional; Region: PRK05926
218497001064	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497001065	FeS/SAM binding site; other site
218497001066	Protein of unknown function (DUF3604); Region: DUF3604; pfam12228
218497001067	Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation; Region: STAS_anti-anti-sigma_factors; cd07043
218497001068	anti sigma factor interaction site; other site
218497001069	regulatory phosphorylation site [posttranslational modification]; other site
218497001070	Pfam match to entry PF01740 STAS, STAS domain , score 107.3, E-value 1.9e-29
218497001071	FOG: CBS domain [General function prediction only]; Region: COG0517
218497001072	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
218497001073	Transporter associated domain; Region: CorC_HlyC; cl08393
218497001074	Pfam match to entry PF03471 CorC_HlyC, Transporter associated domain , score 89.3, E-value 5.2e-24
218497001075	Pfam match to entry PF00571 CBS, CBS domain , score 30.2, E-value 3.1e-06
218497001076	Pfam match to entry PF00571 CBS, CBS domain , score 37.4, E-value 2.1e-08
218497001077	4 probable transmembrane helices predicted for CAB230 by TMHMM2.0 at aa 2-19, 39-61, 73-95 and 100-119
218497001078	Signal peptide predicted for CAB230 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.604 between residues 20 and 21
218497001079	Uncharacterized protein family UPF0054; Region: UPF0054; cl00402
218497001080	Pfam match to entry PF02130 UPF0054, Uncharacterized protein family UPF0054 , score -5.2, E-value 0.00016
218497001081	Chlam_Verruc_Plancto small basic protein; Region: Chlam_Ver_rRNA; TIGR04137
218497001082	Protein of unknown function (DUF502); Region: DUF502; cl01107
218497001083	Signal peptide predicted for CAB234 by SignalP 2.0 HMM (Signal peptide probabilty 0.993) with cleavage site probability 0.408 between residues 23 and 24
218497001084	Alkyladenine DNA glycosylase catalyzes the first step in base excision repair; Region: AAG; cd00540
218497001085	active site
218497001086	DNA binding site [nucleotide binding]
218497001087	Pfam match to entry PF02245 Pur_DNA_glyco, Methylpurine-DNA glycosylase (MPG) , score 292.7, E-value 2.9e-85
218497001088	Exoribonuclease R [Transcription]; Region: VacB; COG0557
218497001089	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
218497001090	RNB domain; Region: RNB; pfam00773
218497001091	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
218497001092	RNA binding site [nucleotide binding]; other site
218497001093	PS01175 Ribonuclease II family signature.
218497001094	Pfam match to entry PF00773 RNB, RNB-like protein , score 519.0, E-value 2.2e-153
218497001095	molecular chaperone DnaK; Provisional; Region: dnaK; PRK00290
218497001096	Pfam match to entry PF00012 HSP70, Hsp70 protein , score 1350.0, E-value 0
218497001097	PS01036 Heat shock hsp70 proteins family signature 3.
218497001098	PS00329 Heat shock hsp70 proteins family signature 2.
218497001099	PS00297 Heat shock hsp70 proteins family signature 1.
218497001100	heat shock protein GrpE; Provisional; Region: PRK14141
218497001101	GrpE is the adenine nucleotide exchange factor of DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the ATPase domain of Hsp70 catalyzing the dissociation of ADP, which enables rebinding of ATP, one step in the Hsp70 reaction cycle in protein folding; Region: GrpE; cd00446
218497001102	dimer interface [polypeptide binding]; other site
218497001103	hsp70 (ATPase domain) interactions [polypeptide binding]; other site
218497001104	Pfam match to entry PF01025 GrpE, GrpE , score 228.6, E-value 6e-66
218497001105	PS01071 grpE protein signature.
218497001106	heat-inducible transcription repressor; Provisional; Region: hrcA; PRK00082
218497001107	HrcA protein C terminal domain; Region: HrcA; pfam01628
218497001108	Pfam match to entry PF01628 HrcA, HrcA protein C terminal domain , score 211.1, E-value 1.1e-60
218497001109	prolyl-tRNA synthetase; Provisional; Region: PRK09194
218497001110	Prolyl-tRNA synthetase (ProRS) class II core catalytic domain. ProRS is a homodimer. It is responsible for the attachment of proline to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of...; Region: ProRS_core_prok; cd00779
218497001111	dimer interface [polypeptide binding]; other site
218497001112	motif 1; other site
218497001113	active site
218497001114	motif 2; other site
218497001115	INS is an amino acid-editing domain inserted (INS) into the bacterial class II prolyl-tRNA synthetase (ProRS) however, this CD is not exclusively bacterial. It is also found at the N-terminus of the eukaryotic/archaea-like ProRS's of yeasts and...; Region: ProRS-INS; cd04334
218497001116	putative deacylase active site [active]
218497001117	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it attaches...; Region: class_II_aaRS-like_core; cl00268
218497001118	active site
218497001119	motif 3; other site
218497001120	ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria. ProRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding; Region: ProRS_anticodon_short; cd00861
218497001121	anticodon binding site; other site
218497001122	Pfam match to entry PF03129 HGTP_anticodon, Anticodon binding domain , score 79.5, E-value 4.4e-21
218497001123	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001124	Pfam match to entry PF00587 tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) , score 170.7, E-value 1.5e-48
218497001125	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
218497001126	Signal peptide predicted for CAB242 by SignalP 2.0 HMM (Signal peptide probabilty 0.951) with cleavage site probability 0.746 between residues 34 and 35
218497001127	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497001128	Uncharacterised ACR, YggU family COG1872; Region: DUF167; cl00811
218497001129	Pfam match to entry PF02594 DUF167, Uncharacterized ACR, YggU family COG1872 , score 122.8, E-value 4.2e-34
218497001130	Type 1 periplasmic binding fold superfamily; Region: Periplasmic_Binding_Protein_Type_1; cl10011
218497001131	Signal peptide predicted for CAB244 by SignalP 2.0 HMM (Signal peptide probabilty 0.975) with cleavage site probability 0.813 between residues 25 and 26
218497001132	LL-diaminopimelate aminotransferase; Region: DAPAT_plant; TIGR03542
218497001133	Aspartate aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). Pyridoxal phosphate combines with an alpha-amino acid to form a compound called a Schiff base or aldimine...; Region: AAT_like; cd00609
218497001134	pyridoxal 5'-phosphate binding site [chemical binding]; other site
218497001135	homodimer interface [polypeptide binding]; other site
218497001136	catalytic residue [active]
218497001137	Pfam match to entry PF00155 aminotran_1_2, Aminotransferase class I and II , score 48.8, E-value 8.1e-12
218497001138	PS00105 Aminotransferases class-I pyridoxal-phosphate attachment site.
218497001139	Protein of unknown function (DUF1207); Region: DUF1207; pfam06727
218497001140	Signal peptide predicted for CAB247 by SignalP 2.0 HMM (Signal peptide probabilty 0.991) with cleavage site probability 0.841 between residues 31 and 32
218497001141	DNA recombination-mediator protein A; Region: DNA_processg_A; cl00695
218497001142	Uncharacterised protein family (UPF0160); Region: UPF0160; cl01749
218497001143	Pfam match to entry PF03690 UPF0160, Uncharacterised protein family (UPF0160) , score 541.0, E-value 5.2e-160
218497001144	Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides. The members of this subgroup have a conserved HxHxHxx motif (x is a...; Region: PKCI_related; cd01276
218497001145	nucleotide binding site/active site [active]
218497001146	Pfam match to entry PF01230 HIT, HIT family , score 166.9, E-value 2.2e-47
218497001147	PS00892 HIT family signature.
218497001148	HEAT repeats; Region: HEAT_2; pfam13646
218497001149	Sodium:solute symporter family; Region: SSF; cl00456
218497001150	13 probable transmembrane helices predicted for CAB252 by TMHMM2.0 at aa 6-28, 49-71, 76-98, 129-148, 163-182, 189-208, 218-240, 261-283, 298-320, 341-363, 368-390, 397-419 and 423-445
218497001151	Pfam match to entry PF00474 SSF, Sodium:solute symporter family , score -56.1, E-value 4.9e-07
218497001152	1 probable transmembrane helix predicted for CAB253 by TMHMM2.0 at aa 7-24
218497001153	Similar to many proposed to be involved in aromatic amino acid biosynthesis including: Bacillus subtilis AroA aroA SWALL:AROG_BACSU (SWALL:P39912) (358 aa) fasta scores: E(): 3.4e-34, 42.56% id in 242 aa, and to Chlamydia pneumoniae deoxyheptonate aldolase arog or cpn0484 or cp0270 SWALL:Q9Z867 (EMBL:AE001633) (285 aa) fasta scores: E(): 1.6e-76, 74.62% id in 268 aa. Note, lacks an appropriate translational start site.; aldolase (pseudogene)
218497001154	Pfam match to entry PF00793 DAHP_synth_1, DAHP synthetase I family , score 348.2, E-value 5.7e-102
218497001155	OTU-like cysteine protease; Region: OTU; cl14910
218497001156	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
218497001157	1 probable transmembrane helix predicted for CAB255 by TMHMM2.0 at aa 34-56
218497001158	Bacterial periplasmic transport systems use membrane-bound complexes and substrate-bound, membrane-associated, periplasmic binding proteins (PBPs) to transport a wide variety of  substrates, such as, amino acids, peptides, sugars, vitamins and inorganic...; Region: PBPb; cd00134
218497001159	Bacterial extracellular solute-binding proteins, family 3; Region: SBP_bac_3; pfam00497
218497001160	substrate binding pocket [chemical binding]; other site
218497001161	membrane-bound complex binding site; other site
218497001162	hinge residues; other site
218497001163	Signal peptide predicted for CAB256 by SignalP 2.0 HMM (Signal peptide probabilty 0.925) with cleavage site probability 0.619 between residues 27 and 28
218497001164	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497001165	Pfam match to entry PF00497 SBP_bac_3, Bacterial extracellular solute-binding proteins, family 3 , score 137.4, E-value 1.7e-38
218497001166	2 probable transmembrane helices predicted for CAB257 by TMHMM2.0 at aa 107-129 and 139-161
218497001167	Metallo-beta-lactamase superfamily; Region: Lactamase_B; cl00446
218497001168	Pfam match to entry PF00753 lactamase_B, Metallo-beta-lactamase superfamily , score 13.5, E-value 0.00017
218497001169	GTP-binding protein HflX; Region: GTP_HflX; TIGR03156
218497001170	HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual...; Region: HflX; cd01878
218497001171	G1 box; other site
218497001172	GTP/Mg2+ binding site [chemical binding]; other site
218497001173	Switch I region; other site
218497001174	G2 box; other site
218497001175	G3 box; other site
218497001176	Switch II region; other site
218497001177	G4 box; other site
218497001178	G5 box; other site
218497001179	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001180	Uncharacterized protein family UPF0004; Region: UPF0004; pfam00919
218497001181	MiaB-like tRNA modifying enzyme; Region: MiaB-like-C; TIGR01579
218497001182	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497001183	FeS/SAM binding site; other site
218497001184	Pfam match to entry PF00919 UPF0004, Uncharacterized protein family UPF0004 , score 36.8, E-value 7.4e-10
218497001185	PS01278 Uncharacterized protein family UPF0004 signature.
218497001186	glycogen branching enzyme; Provisional; Region: PRK05402
218497001187	N-terminal Early set domain associated with the catalytic domain of prokaryotic glycogen branching enzyme; Region: E_set_GBE_prok_N; cd02855
218497001188	Alpha amylase, catalytic domain; Region: Alpha-amylase; cl07893
218497001189	Alpha amylase, C-terminal all-beta domain; Region: Alpha-amylase_C; cl02706
218497001190	Pfam match to entry PF02922 isoamylase_N, Isoamylase N-terminal domain , score 104.3, E-value 1.5e-28
218497001191	Pfam match to entry PF00128 alpha-amylase, Alpha amylase, catalytic domain , score -39.6, E-value 2e-08
218497001192	10 probable transmembrane helices predicted for CAB263 by TMHMM2.0 at aa 54-76, 86-108, 127-149, 159-181, 210-232, 242-264, 353-375, 390-409, 478-500 and 504-526
218497001193	adhesin; Provisional; Region: PRK09752
218497001194	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001195	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001196	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001197	Pfam match to entry PF03797 Autotransporter, Autotransporter beta-domain , score 34.8, E-value 1.3e-07
218497001198	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score -43.0, E-value 7.9e-08
218497001199	Signal peptide predicted for CAB265 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.686 between residues 25 and 26
218497001200	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497001201	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001202	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001203	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001204	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score -39.5, E-value 5.7e-08
218497001205	8 x poly G tract
218497001206	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001207	Signal peptide predicted for CAB267 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 1.000 between residues 24 and 25
218497001208	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001209	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001210	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001211	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score -55.8, E-value 2.5e-07
218497001212	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001213	Signal peptide predicted for CAB268 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.689 between residues 24 and 25
218497001214	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001215	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001216	Pfam match to entry PF03797 Autotransporter, Autotransporter beta-domain , score -1.3, E-value 0.0003
218497001217	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 245.5, E-value 4.8e-71
218497001218	Signal peptide predicted for CAB269 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.972 between residues 24 and 25
218497001219	Similar to Chlamydophila abortus  98 kDa outer membrane protein SWALL:P71135 (EMBL:U72499) (926 aa) fasta scores: E(): 1.9e-47, 29.68% id in 923 aa, and to Chlamydia pneumoniae probable outer membrane protein Pmp7 precursor or omp12 or cpn0445 or cp0308 SWALL:PMP7_CHLPN (SWALL:Q9Z898) (936 aa) fasta scores: E(): 4.9e-42, 29.54% id in 819 aa. Note this CDS carries multiple frameshift mutations.;polymorphic outer membrane protein (pseudogene)
218497001220	homopolymeric tract
218497001221	PS00389 ATP synthase delta (OSCP) subunit signature.
218497001222	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score -47.4, E-value 1.2e-07
218497001223	Signal peptide predicted for CAB272 by SignalP 2.0 HMM (Signal peptide probabilty 0.975) with cleavage site probability 0.478 between residues 25 and 26
218497001224	Similar to Chlamydophila abortus  98 kDa outer membrane protein SWALL:P71135 (EMBL:U72499) (926 aa) fasta scores: E(): 2.5e-47, 29.97% id in 1001 aa, and to Chlamydia psittaci pomp90b precursor SWALL:P77792 (EMBL:U65943) (839 aa) fasta scores: E(): 1.2e-42, 31.89% id in 975 aa Note this CDS carries multiple frameshift mutations;polymorphic outer membrane protein (pseudogene)
218497001225	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 59.6, E-value 4.9e-17
218497001226	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 47.9, E-value 9.2e-14
218497001227	Signal peptide predicted for CAB276 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.595 between residues 22 and 23
218497001228	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001229	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001230	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 242.0, E-value 5.6e-70
218497001231	Signal peptide predicted for CAB277 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.579 between residues 23 and 24
218497001232	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001233	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001234	Pfam match to entry PF03797 Autotransporter, Autotransporter beta-domain , score 2.5, E-value 0.00019
218497001235	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 190.0, E-value 2.5e-54
218497001236	Signal peptide predicted for CAB278 by SignalP 2.0 HMM (Signal peptide probabilty 0.991) with cleavage site probability 0.939 between residues 29 and 30
218497001237	Similar to Chlamydia psittaci pomp90b precursor SWALL:P77792 (EMBL:U65943) (839 aa) fasta scores: E(): 0, 98.45% id in 841 aa, and to Chlamydophila abortus pomp91a SWALL:P71132 (EMBL:U65942) (847 aa) fasta scores: E(): 0, 77.97% id in 849 aa. Note the frameshift mutation of this CDS occurs in a homopolymeric tract, consequently the expression of its exported protein product is thought to be phase variable;polymorphic outer membrane protein (pseudogene)
218497001238	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 671.6, E-value 2.6e-199
218497001239	17 x poly G tract and the site of the frameshift. This is a candidate site for phase variation of the expression of this gene and its complete product
218497001240	Signal peptide predicted for CAB280 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.956 between residues 23 and 24
218497001241	adhesin; Provisional; Region: PRK09752
218497001242	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001243	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001244	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001245	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 697.4, E-value 4.5e-207
218497001246	10 x poly G tract
218497001247	Signal peptide predicted for CAB281 by SignalP 2.0 HMM (Signal peptide probabilty 0.970) with cleavage site probability 0.969 between residues 22 and 23
218497001248	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001249	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001250	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001251	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001252	Pfam match to entry PF03797 Autotransporter, Autotransporter beta-domain , score 6.5, E-value 0.00011
218497001253	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 15.2, E-value 0.00014
218497001254	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 719.0, E-value 1.4e-213
218497001255	Signal peptide predicted for CAB282 by SignalP 2.0 HMM (Signal peptide probabilty 0.991) with cleavage site probability 0.977 between residues 30 and 31
218497001256	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001257	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497001258	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497001259	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497001260	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 17.3, E-value 3.6e-05
218497001261	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 69.2, E-value 5.7e-18
218497001262	Signal peptide predicted for CAB283 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.984 between residues 34 and 35
218497001263	Domain of unknown function (DUF378); Region: DUF378; cl00943
218497001264	2 probable transmembrane helices predicted for CAB284 by TMHMM2.0 at aa 5-27 and 42-64
218497001265	Glu-tRNAGln amidotransferase C subunit; Region: Glu-tRNAGln; cl00495
218497001266	Pfam match to entry PF02686 Glu-tRNAGln, Glu-tRNAGln amidotransferase C subunit , score 57.1, E-value 2.4e-14
218497001267	Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related amidases [Translation, ribosomal structure and biogenesis]; Region: GatA; COG0154
218497001268	GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) catalyzes the formation of pyroglutamic acid (5-oxoproline) from dipeptides containing gamma-glutamyl, and is a dimeric protein. In Homo sapiens, the protein is...; Region: GGCT_like; cl11426
218497001269	Pfam match to entry PF01425 Amidase, Amidase , score 629.5, E-value 1.3e-186
218497001270	PS00571 Amidases signature.
218497001271	aspartyl/glutamyl-tRNA amidotransferase subunit B; Validated; Region: gatB; PRK05477
218497001272	GatB/GatE catalytic domain; Region: GatB_N; pfam02934
218497001273	GatB domain; Region: GatB_Yqey; cl11497
218497001274	Pfam match to entry PF02934 GatB_N, PET112 family, N terminal region , score 469.3, E-value 2e-138
218497001275	PS01234 PET112 family signature.
218497001276	Pfam match to entry PF01162 GatB, PET112 family, C terminal region , score 114.6, E-value 1.2e-31
218497001277	Predicted helix-turn-helix motif with score 1128.000, SD 3.03 at aa 335-356, sequence AHFFELAAQECKNYRALSNWLT
218497001278	Pfam match to entry PF02637 DUF186, GatB/Yqey domain , score 212.3, E-value 4.6e-61
218497001279	4 probable transmembrane helices predicted for CAB288 by TMHMM2.0 at aa 75-97, 102-124, 139-161 and 168-190
218497001280	3 probable transmembrane helices predicted for CAB289 by TMHMM2.0 at aa 41-63, 89-111 and 118-137
218497001281	ribonuclease HIII; Provisional; Region: PRK00996
218497001282	Domain of unknown function (DUF3378); Region: DUF3378; pfam11858
218497001283	bacterial Ribonuclease HIII-like; Region: RNase_HII_bacteria_HIII_like; cd06590
218497001284	RNA/DNA hybrid binding site [nucleotide binding]; other site
218497001285	active site
218497001286	Pfam match to entry PF01351 RNase_HII, Ribonuclease HII , score 35.6, E-value 8.8e-11
218497001287	Helix-turn-helix XRE-family like proteins. Prokaryotic DNA binding proteins belonging to the xenobiotic response element family of transcriptional regulators; Region: HTH_XRE; cl00088
218497001288	1 probable transmembrane helix predicted for CAB292 by TMHMM2.0 at aa 103-125
218497001289	PS00697 ATP-dependent DNA ligase AMP-binding site.
218497001290	Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl11391
218497001291	Signal peptide predicted for CAB296 by SignalP 2.0 HMM (Signal peptide probabilty 0.961) with cleavage site probability 0.569 between residues 30 and 31
218497001292	Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl11391
218497001293	Signal peptide predicted for CAB297 by SignalP 2.0 HMM (Signal peptide probabilty 0.638) with cleavage site probability 0.231 between residues 30 and 31
218497001294	Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones]; Region: COG1331
218497001295	TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif. The human/rat protein; Region: SSP411; cd02955
218497001296	catalytic residues [active]
218497001297	LanC-like proteins. LanC is the cyclase enzyme of the lanthionine synthetase. Lanthionine is a lantibiotic, a unique class of peptide antibiotics. They are ribosomally synthesized as a precursor peptide and then post-translationally modified to contain...; Region: LanC_like; cl04955
218497001298	active site
218497001299	Pfam match to entry PF03190 DUF255, Protein of unknown function, DUF255 , score 167.2, E-value 1.8e-47
218497001300	PS00589 PTS HPR component serine phosphorylation site signature.
218497001301	Signal peptide predicted for CAB299 by SignalP 2.0 HMM (Signal peptide probabilty 0.975) with cleavage site probability 0.855 between residues 23 and 24
218497001302	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl12011
218497001303	Pfam match to entry PF00398 RrnaAD, Ribosomal RNA adenine dimethylase , score 194.1, E-value 1.4e-55
218497001304	PS01131 Ribosomal RNA adenine dimethylases signature.
218497001305	1-deoxy-D-xylulose-5-phosphate synthase; Provisional; Region: PRK05444
218497001306	Thiamine pyrophosphate (TPP) family, DXS subfamily, TPP-binding module; 1-Deoxy-D-xylulose-5-phosphate synthase (DXS) is a regulatory enzyme of the mevalonate-independent pathway involved in terpenoid biosynthesis. Terpeniods are plant natural products...; Region: TPP_DXS; cd02007
218497001307	TPP-binding site; other site
218497001308	Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins; Region: TPP_PYR_DXS_TK_like; cd07033
218497001309	PYR/PP interface [polypeptide binding]; other site
218497001310	dimer interface [polypeptide binding]; other site
218497001311	TPP binding site [chemical binding]; other site
218497001312	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
218497001313	Pfam match to entry PF02780 transketolase_C, Transketolase, C-terminal domain , score 117.7, E-value 1.5e-32
218497001314	Pfam match to entry PF02779 transket_pyr, Transketolase, pyridine binding domain , score 172.1, E-value 6e-49
218497001315	PS00801 Transketolase signature 1.
218497001316	Exonuclease VII small subunit; Region: Exonuc_VII_S; cl00750
218497001317	Pfam match to entry PF02609 Exonuc_VII_S, Exonuclease VII small subunit , score 40.5, E-value 2.5e-09
218497001318	exodeoxyribonuclease VII large subunit; Reviewed; Region: xseA; PRK00286
218497001319	ExoVII_LU_OBF: A subfamily of OB folds corresponding to the N-terminal OB-fold domain of Escherichia coli exodeoxyribonuclease VII (ExoVII) large subunit. E. coli ExoVII is composed of two non-identical subunits. E. coli ExoVII is a...; Region: ExoVII_LU_OBF; cd04489
218497001320	generic binding surface II; other site
218497001321	generic binding surface I; other site
218497001322	exodeoxyribonuclease VII large subunit; Reviewed; Region: xseA; PRK00286
218497001323	Pfam match to entry PF02601 Exonuc_VII_L, Exonuclease VII, large subunit , score 308.9, E-value 3.9e-90
218497001324	Pfam match to entry PF01336 tRNA_anti, OB-fold nucleic acid binding domain , score 26.6, E-value 3.8e-05
218497001325	Triosephosphate isomerase (TIM) is a glycolytic enzyme that catalyzes the interconversion of dihydroxyacetone phosphate and D-glyceraldehyde-3-phosphate. The reaction is very efficient and requires neither cofactors nor metal ions. TIM, usually...; Region: TIM; cd00311
218497001326	substrate binding site [chemical binding]; other site
218497001327	dimer interface [polypeptide binding]; other site
218497001328	catalytic triad [active]
218497001329	Pfam match to entry PF00121 TIM, Triosephosphate isomerase , score 310.0, E-value 1.8e-90
218497001330	PS00171 Triosephosphate isomerase active site.
218497001331	Preprotein translocase SecG subunit; Region: SecG; cl09123
218497001332	Signal peptide predicted for CAB306 by SignalP 2.0 HMM (Signal peptide probabilty 0.933) with cleavage site probability 0.704 between residues 38 and 39
218497001333	Pfam match to entry PF03840 SecG, Preprotein translocase SecG subunit , score 88.5, E-value 8.9e-24
218497001334	probable transmembrane helices predicted for CAB306 by TMHMM2.0 at aa 57-79
218497001335	Polypeptide or peptide deformylase; a family of metalloenzymes that catalyzes the removal of the N-terminal formyl group in a growing polypeptide chain following translation initiation during protein synthesis in prokaryotes. These enzymes utilize Fe(II)...; Region: Pep_deformylase; cd00487
218497001336	active site
218497001337	catalytic residues [active]
218497001338	metal binding site [ion binding]; metal-binding site
218497001339	Pfam match to entry PF01327 Pep_deformylase, Polypeptide deformylase , score 177.3, E-value 1.6e-50
218497001340	PS00436 Peroxidases active site signature.
218497001341	Signal peptide predicted for CAB308 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.623 between residues 22 and 23
218497001342	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497001343	FOG: HEAT repeat [Energy production and conversion]; Region: COG1413
218497001344	Pfam match to entry PF03130 HEAT_PBS, PBS lyase HEAT-like repeat , score 20.2, E-value 0.0032
218497001345	Signal peptide predicted for CAB309 by SignalP 2.0 HMM (Signal peptide probabilty 0.923) with cleavage site probability 0.750 between residues 22 and 23
218497001346	Maf-like protein; Region: Maf; pfam02545
218497001347	Nucleotide binding protein Maf. Maf has been implicated in inhibition of septum formation in eukaryotes, bacteria and archaea, but homologs in B.subtilis and S.cerevisiae are nonessential for cell division. Maf has been predicted to be a nucleotide- or...; Region: Maf; cd00555
218497001348	active site
218497001349	dimer interface [polypeptide binding]; other site
218497001350	Pfam match to entry PF02545 Maf, Maf-like protein , score 294.5, E-value 8.7e-86
218497001351	ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated...; Region: ABCF_EF-3; cd03221
218497001352	ABC transporter ATP-binding protein; Provisional; Region: PRK15064
218497001353	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497001354	ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated...; Region: ABCF_EF-3; cd03221
218497001355	ABC transporter; Region: ABC_tran_2; pfam12848
218497001356	ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated...; Region: ABCF_EF-3; cd03221
218497001357	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 120.3, E-value 2.4e-33
218497001358	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001359	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 109.7, E-value 3.7e-30
218497001360	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001361	site-specific tyrosine recombinase XerC; Reviewed; Region: xerC; PRK00236
218497001362	XerD and XerC integrases, DNA breaking-rejoining enzymes, N- and C-terminal domains. XerD-like integrases are involved in the site-specific integration and excision of lysogenic bacteriophage genomes, transposition of conjugative transposons, termination...; Region: INT_XerDC; cd00798
218497001363	Int/Topo IB signature motif; other site
218497001364	active site
218497001365	Pfam match to entry PF00589 Phage_integrase, Phage integrase , score 171.6, E-value 8.4e-49
218497001366	Pfam match to entry PF02899 Phage_integr_N, Phage integrase, N-terminal SAM-like domain , score 45.9, E-value 6e-11
218497001367	Metallo-beta-lactamase superfamily; Region: Lactamase_B; cl00446
218497001368	Pfam match to entry PF00753 lactamase_B, Metallo-beta-lactamase superfamily , score 18.0, E-value 2.1e-05
218497001369	IncA protein; Region: IncA; pfam04156
218497001370	probable transmembrane helices predicted for CAB314 by TMHMM2.0 at aa 69-91
218497001371	Signal peptide predicted for CAB314 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.980 between residues 64 and 65
218497001372	ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones]; Region: Lon; COG0466
218497001373	Found in ATP-dependent protease La (LON); Region: LON; smart00464
218497001374	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497001375	Walker A motif; other site
218497001376	ATP binding site [chemical binding]; other site
218497001377	Walker B motif; other site
218497001378	arginine finger; other site
218497001379	Lon protease (S16) C-terminal proteolytic domain; Region: Lon_C; pfam05362
218497001380	PS01046 ATP-dependent serine proteases, lon family, serine active site.
218497001381	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 167.8, E-value 1.2e-47
218497001382	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001383	Pfam match to entry PF02190 LON, ATP-dependent protease La (LON) domain , score 96.7, E-value 3e-26
218497001384	Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones]; Region: COG1214; cl14000
218497001385	Ribosomal protein S21; Region: Ribosomal_S21; cl00529
218497001386	Pfam match to entry PF01165 Ribosomal_S21, Ribosomal protein S21 , score 44.4, E-value 1.7e-10
218497001387	chaperone protein DnaJ; Provisional; Region: PRK14284
218497001388	DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock protein 40) proteins are highly conserved and play crucial roles in protein translation, folding, unfolding, translocation, and degradation. They act primarily by stimulating the ATPase activity of Hsp70s; Region: DnaJ; cd06257
218497001389	HSP70 interaction site [polypeptide binding]; other site
218497001390	Zinc finger domain of DnaJ and HSP40; Region: DnaJ_zf; cd10719
218497001391	Zn binding sites [ion binding]; other site
218497001392	C-terminal substrate binding domain of DnaJ and HSP40; Region: DnaJ_C; cd10747
218497001393	dimer interface [polypeptide binding]; other site
218497001394	Pfam match to entry PF00226 DnaJ, DnaJ domain , score 156.8, E-value 2.4e-44
218497001395	PS00636 Nt-dnaJ domain signature.
218497001396	Pfam match to entry PF00684 DnaJ_CXXCXGXG, DnaJ central domain (4 repeats) , score 88.2, E-value 1.1e-23
218497001397	PS00637 CXXCXGXG dnaJ domain signature.
218497001398	Pfam match to entry PF01556 DnaJ_C, DnaJ C terminal region , score 201.2, E-value 1e-57
218497001399	Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, alpha subunit [Energy production and conversion]; Region: AcoA; COG1071
218497001400	Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain...; Region: TPP_E1_PDC_ADC_BCADC; cd02000
218497001401	tetramer interface [polypeptide binding]; other site
218497001402	TPP-binding site [chemical binding]; other site
218497001403	heterodimer interface [polypeptide binding]; other site
218497001404	phosphorylation loop region [posttranslational modification]
218497001405	Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion]; Region: AcoB; COG0022
218497001406	Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins; Region: TPP_PYR_E1-PDHc-beta_like; cd07036
218497001407	alpha subunit interface [polypeptide binding]; other site
218497001408	TPP binding site [chemical binding]; other site
218497001409	heterodimer interface [polypeptide binding]; other site
218497001410	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
218497001411	Pfam match to entry PF00676 E1_dehydrog, Dehydrogenase E1 component , score 116.4, E-value 3.5e-32
218497001412	Pfam match to entry PF02779 transket_pyr, Transketolase, pyridine binding domain , score 246.1, E-value 3.2e-71
218497001413	Pfam match to entry PF02780 transketolase_C, Transketolase, C-terminal domain , score 183.2, E-value 2.8e-52
218497001414	Similar to several Chlamydophila proteins of unknown function e.g. Chlamydophila caviae hypothetical protein Cca00325 SWALL:Q823T0 (EMBL:AE016995) (345 aa) fasta scores: E(): 2.5e-62, 51.45% id in 344 aa and to Chlamydia pneumoniae hypothetical protein Cp0742 SWALL:Q9K1Z7 (EMBL:AE002233) (425 aa) fasta scores: E(): 4.9e-21, 31.12% id in 241 aa. Note this CDS appears to have a frameshift mutation following codon 231; membrane protein (pseudogene)
218497001415	2 probable transmembrane helices predicted for CAB321 by TMHMM2.0 at aa 35-57 and 61-75
218497001416	Competence protein; Region: Competence; cl00471
218497001417	Pfam match to entry PF03772 Competence, Competence protein , score 66.0, E-value 5.3e-17
218497001418	5 probable transmembrane helices predicted for CAB322 by TMHMM2.0 at aa 232-254, 261-283, 324-346, 358-380 and 395-417
218497001419	Histidine-containing phosphocarrier protein (HPr)-like proteins. HPr is a central component of the bacterial phosphoenolpyruvate sugar phosphotransferase system (PTS). The PTS catalyses the phosphorylation of sugar substrates during their translocation...; Region: PTS-HPr_like; cd00367
218497001420	dimerization domain swap beta strand [polypeptide binding]; other site
218497001421	regulatory protein interface [polypeptide binding]; other site
218497001422	active site
218497001423	regulatory phosphorylation site [posttranslational modification]; other site
218497001424	Pfam match to entry PF00381 PTS-HPr, PTS HPr component phosphorylation site , score 43.4, E-value 3.3e-10
218497001425	PS00589 PTS HPR component serine phosphorylation site signature.
218497001426	phosphoenolpyruvate-protein phosphotransferase; Region: PTS_I_fam; TIGR01417
218497001427	PEP-utilising enzyme, N-terminal; Region: PEP-utilisers_N; pfam05524
218497001428	PEP-utilising enzyme, mobile domain; Region: PEP-utilizers; cl01586
218497001429	Pyruvate kinase (PK):  Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low...; Region: Pyruvate_Kinase; cl09155
218497001430	Pfam match to entry PF00391 PEP-utilizers, PEP-utilizing enzyme, mobile domain , score 73.3, E-value 3.4e-19
218497001431	PS00370 PEP-utilizing enzymes phosphorylation site signature.
218497001432	Pfam match to entry PF02896 PEP-utilizers_C, PEP-utilizing enzyme, TIM barrel domain , score 138.1, E-value 1e-38
218497001433	PS00742 PEP-utilizing enzymes signature 2.
218497001434	Uncharacterised BCR, YbaB family COG0718; Region: DUF149; cl00494
218497001435	Pfam match to entry PF02575 DUF149, Uncharacterized BCR, YbaB family COG0718 , score 110.6, E-value 2e-30
218497001436	DNA polymerase III subunits gamma and tau; Validated; Region: PRK06305
218497001437	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497001438	Walker A motif; other site
218497001439	ATP binding site [chemical binding]; other site
218497001440	Walker B motif; other site
218497001441	arginine finger; other site
218497001442	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 27.5, E-value 5.4e-07
218497001443	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001444	Predicted membrane-associated HD superfamily hydrolase [General function prediction only]; Region: COG1480
218497001445	7TM receptor with intracellular HD hydrolase; Region: 7TM-7TMR_HD; pfam07698
218497001446	Metal dependent phosphohydrolases with conserved 'HD' motif; Region: HDc; cd00077
218497001447	Zn2+ binding site [ion binding]; other site
218497001448	Mg2+ binding site [ion binding]; other site
218497001449	7 probable transmembrane helices predicted for CAB328 by TMHMM2.0 at aa 28-50, 260-282, 295-317, 337-359, 366-385, 395-417 and 430-452
218497001450	Pfam match to entry PF01966 HD, HD domain , score 70.8, E-value 1.9e-18
218497001451	3 probable transmembrane helices predicted for CAB329 by TMHMM2.0 at aa 47-69, 95-117 and 121-143
218497001452	2 probable transmembrane helices predicted for CAB330 by TMHMM2.0 at aa 48-65 and 110-132
218497001453	2 probable transmembrane helices predicted for CAB331 by TMHMM2.0 at aa 45-67 and 98-120
218497001454	porphobilinogen deaminase; Provisional; Region: PRK01066
218497001455	Hydroxymethylbilane synthase (HMBS), also known as porphobilinogen deaminase (PBGD), is an intermediate enzyme in the biosynthetic pathway of tetrapyrrolic ring systems, such as heme, chlorophylls, and vitamin B12. HMBS catalyzes the conversion of...; Region: HMBS; cl03189
218497001456	domain interfaces; other site
218497001457	active site
218497001458	Pfam match to entry PF01379 Porphobil_deam, Porphobilinogen deaminase, dipyromethane cofactor binding domain , score 55.1, E-value 1e-17
218497001459	DNA repair protein RadA; Provisional; Region: PRK11823
218497001460	Sms (bacterial radA) DNA repair protein. This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of...; Region: Sms; cd01121
218497001461	Walker A motif/ATP binding site; other site
218497001462	ATP binding site [chemical binding]; other site
218497001463	Walker B motif; other site
218497001464	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001465	ribonuclease III, bacterial; Region: RNaseIII; TIGR02191
218497001466	RIBOc. Ribonuclease III C terminal domain. This group consists of eukaryotic, bacterial and archeal ribonuclease III (RNAse III) proteins. RNAse III is a double stranded RNA-specific endonuclease. Prokaryotic RNAse III is important in...; Region: RIBOc; cd00593
218497001467	dimerization interface [polypeptide binding]; other site
218497001468	active site
218497001469	metal binding site [ion binding]; metal-binding site
218497001470	Double-stranded RNA binding motif. Binding is not sequence specific but is highly specific for double stranded RNA. Found in a variety of proteins including dsRNA dependent protein kinase PKR, RNA helicases, Drosophila staufen protein, E. coli RNase III; Region: DSRM; cd00048
218497001471	Pfam match to entry PF00035 dsrm, Double-stranded RNA binding motif , score 70.6, E-value 2.1e-18
218497001472	Pfam match to entry PF00636 Ribonuclease_3, RNase3 domain , score 151.0, E-value 1.4e-42
218497001473	PS00517 Ribonuclease III family signature.
218497001474	phosphoglucomutase-2-like protein; Provisional; Region: PTZ00150
218497001475	This CD includes PGM2 (phosphoglucomutase 2) and PGM2L1 (phosphoglucomutase 2-like 1). The mammalian PGM2 is thought to be a phosphopentomutase that catalyzes the conversion of the nucleoside breakdown products, ribose-1-phosphate and...; Region: PGM2; cd05799
218497001476	active site
218497001477	substrate binding site [chemical binding]; other site
218497001478	metal binding site [ion binding]; metal-binding site
218497001479	Pfam match to entry PF02878 PGM_PMM_I, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I , score 187.5, E-value 1.4e-53
218497001480	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
218497001481	Pfam match to entry PF02879 PGM_PMM_II, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II , score 0.5, E-value 0.00036
218497001482	Pfam match to entry PF02880 PGM_PMM_III, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III , score 10.7, E-value 0.0003
218497001483	Superoxide dismutase [Inorganic ion transport and metabolism]; Region: SodA; COG0605
218497001484	Iron/manganese superoxide dismutases, alpha-hairpin domain; Region: Sod_Fe_N; pfam00081
218497001485	Iron/manganese superoxide dismutases, C-terminal domain; Region: Sod_Fe_C; pfam02777
218497001486	Pfam match to entry PF00081 sodfe, Iron/manganese superoxide dismutases, alpha-hairpin domain , score 160.7, E-value 1.6e-45
218497001487	Pfam match to entry PF02777 sodfe_C, Iron/manganese superoxide dismutases, C-terminal domain , score 177.5, E-value 1.4e-50
218497001488	PS00088 Manganese and iron superoxide dismutases signature.
218497001489	acetyl-CoA carboxylase subunit beta; Validated; Region: PRK05654
218497001490	Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit; Region: ACCA; cl00513
218497001491	PS00190 Cytochrome c family heme-binding site signature.
218497001492	Pfam match to entry PF01039 Carboxyl_trans, Carboxyl transferase domain , score 49.4, E-value 7e-14
218497001493	Trimeric dUTP diphosphatases; Region: trimeric_dUTPase; cd07557
218497001494	trimer interface [polypeptide binding]; other site
218497001495	active site
218497001496	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
218497001497	active site
218497001498	phosphorylation site [posttranslational modification]
218497001499	Pfam match to entry PF00359 PTS_EIIA_2, Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 , score 44.4, E-value 1.5e-10
218497001500	PS00372 PTS EIIA domains phosphorylation site signature 2.
218497001501	Helix-Turn-Helix DNA binding domain of truncated MerR-like proteins; Region: HTH_MerR-trunc; cd04762
218497001502	DNA binding residues [nucleotide binding]
218497001503	PTS_IIA, PTS system, fructose/mannitol specific IIA subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This...; Region: PTS_IIA_fru; cd00211
218497001504	active site
218497001505	phosphorylation site [posttranslational modification]
218497001506	Predicted helix-turn-helix motif with score 2001.000, SD 6.00 at aa 3-24, sequence LKLEELASLLDISENTVRRWLD
218497001507	Pfam match to entry PF00359 PTS_EIIA_2, Phosphoenolpyruvate-dependent sugar phosphotransferase system, EIIA 2 , score -2.4, E-value 1.1e-06
218497001508	PS00372 PTS EIIA domains phosphorylation site signature 2.
218497001509	Signal peptide predicted for CAB341 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.852 between residues 28 and 29
218497001510	1 probable transmembrane helix predicted for CAB341 by TMHMM2.0 at aa 423-445
218497001511	4 probable transmembrane helices predicted for CAB342 by TMHMM2.0 at aa 36-58, 63-85, 242-264 and 269-291
218497001512	2 probable transmembrane helices predicted for CAB343 by TMHMM2.0 at aa 30-52 and 59-81
218497001513	2 probable transmembrane helices predicted for CAB344 by TMHMM2.0 at aa 66-88 and 98-120
218497001514	tRNA methyl transferase; Region: tRNA_Me_trans; pfam03054
218497001515	tRNA methyl transferase. This family represents tRNA(5-methylaminomethyl-2-thiouridine)-methyltransferase which is involved in the biosynthesis of the modified nucleoside 5-methylaminomethyl-2-thiouridine present in the wobble position of some tRNAs; Region: tRNA_Me_trans; cd01998
218497001516	Ligand Binding Site [chemical binding]; other site
218497001517	Signal peptide predicted for CAB345 by SignalP 2.0 HMM (Signal peptide probabilty 0.685) with cleavage site probability 0.672 between residues 19 and 20
218497001518	Pfam match to entry PF03054 tRNA_Me_trans, tRNA methyl transferase , score 712.2, E-value 1.5e-211
218497001519	PS00070 Aldehyde dehydrogenases cysteine active site.
218497001520	Clp protease ATP binding subunit; Region: clpC; CHL00095
218497001521	Clp amino terminal domain; Region: Clp_N; pfam02861
218497001522	Clp amino terminal domain; Region: Clp_N; pfam02861
218497001523	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497001524	Walker A motif; other site
218497001525	ATP binding site [chemical binding]; other site
218497001526	Walker B motif; other site
218497001527	arginine finger; other site
218497001528	UvrB/uvrC motif; Region: UVR; pfam02151
218497001529	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497001530	Walker A motif; other site
218497001531	ATP binding site [chemical binding]; other site
218497001532	Walker B motif; other site
218497001533	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; cl11083
218497001534	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 4.7, E-value 3.7e-05
218497001535	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001536	Pfam match to entry PF02151 UVR, UvrB/uvrC motif , score 38.5, E-value 1e-08
218497001537	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 45.6, E-value 7.2e-11
218497001538	PS00870 Chaperonins clpA/B signature 1.
218497001539	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001540	Pfam match to entry PF02861 Clp_N, Clp amino terminal domain , score 71.2, E-value 1.4e-18
218497001541	Pfam match to entry PF02861 Clp_N, Clp amino terminal domain , score 83.3, E-value 3.3e-22
218497001542	PS00307 Legume lectins beta-chain signature.
218497001543	Biotin/lipoate A/B protein ligase family; Region: BPL_LplA_LipB; cl14057
218497001544	Pfam match to entry PF03099 BPL_LipA_LipB, Biotin/lipoate A/B protein ligase , score 71.1, E-value 1.6e-18
218497001545	Phosphatidylserine/phosphatidylglycerophosphate/car diolipin synthases and related enzymes [Lipid metabolism]; Region: Cls; COG1502
218497001546	Catalytic domain of phospholipase D superfamily proteins; Region: PLDc_SF; cl15239
218497001547	putative active site [active]
218497001548	catalytic site [active]
218497001549	Signal peptide predicted for CAB348 by SignalP 2.0 HMM (Signal peptide probabilty 0.936) with cleavage site probability 0.443 between residues 24 and 25
218497001550	Pfam match to entry PF00614 PLDc, Phospholipase D. Active site motif , score 9.1, E-value 0.24
218497001551	PS00214 Cytosolic fatty-acid binding proteins signature.
218497001552	Pfam match to entry PF00614 PLDc, Phospholipase D. Active site motif , score 21.6, E-value 0.0012
218497001553	Chlamydial GcvH-like protein upstream region protein; Region: near_not_gcvH; TIGR03076
218497001554	1 probable transmembrane helix predicted for CAB349 by TMHMM2.0 at aa 13-35
218497001555	Glycine cleavage H-protein. Glycine cleavage H-proteins are part of the glycine cleavage system (GCS) found in bacteria, archea and the mitochondria of eukaryotes. GCS is a multienzyme complex consisting of 4 different components (P-, H-, T- and...; Region: GCS_H; cd06848
218497001556	lipoyl attachment site [posttranslational modification]; other site
218497001557	Pfam match to entry PF01597 GCV_H, Glycine cleavage H-protein , score 43.0, E-value 1.8e-10
218497001558	2 probable transmembrane helices predicted for CAB351 by TMHMM2.0 at aa 27-49 and 54-76
218497001559	Rnf-Nqr subunit, membrane protein; Region: Rnf-Nqr; cl00597
218497001560	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001561	Pfam match to entry PF02508 Rnf-Nqr, Rnf-Nqr subunit, membrane protein , score 326.7, E-value 1.8e-95
218497001562	6 probable transmembrane helices predicted for CAB352 by TMHMM2.0 at aa 15-37, 44-66, 89-111, 118-140, 150-172 and 185-207
218497001563	Rnf-Nqr subunit, membrane protein; Region: Rnf-Nqr; cl00597
218497001564	5 probable transmembrane helices predicted for CAB353 by TMHMM2.0 at aa 72-94, 101-118, 128-147, 154-173 and 183-205
218497001565	Pfam match to entry PF02508 Rnf-Nqr, Rnf-Nqr subunit, membrane protein , score 342.1, E-value 3.9e-100
218497001566	Signal peptide predicted for CAB353 by SignalP 2.0 HMM (Signal peptide probabilty 0.890) with cleavage site probability 0.510 between residues 33 and 34
218497001567	Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrC [Energy production and conversion]; Region: NqrC; COG2869
218497001568	FMN-binding domain; Region: FMN_bind; cl01081
218497001569	Signal peptide predicted for CAB354 by SignalP 2.0 HMM (Signal peptide probabilty 0.979) with cleavage site probability 0.399 between residues 31 and 32
218497001570	NQR2, RnfD, RnfE family; Region: NQR2_RnfD_RnfE; cl00779
218497001571	Pfam match to entry PF03116 NQR2_RnfD_RnfE, NQR2, RnfD, RnfE family , score 993.5, E-value 3.2e-296
218497001572	8 probable transmembrane helices predicted for CAB355 by TMHMM2.0 at aa 57-79, 120-142, 155-177, 356-378, 385-407, 417-439, 452-469 and 473-495
218497001573	Similar to Chlamydia pneumoniae hypothetical protein ct277 SWALL:Q9Z8B7 (EMBL:AE001625) (192 aa) fasta scores: E(): 7.4e-16, 48.88% id in 90 aa. This CDS carries a frameshift mutation following codon 97 which may occur within a 7xT homopolymeric tract leaving open the possibility that the gene product of this CDS is subject to phase variation. Only significant database matches are to Chlamydiaceae proteins.;conserved hypothetical protein (pseudogene)
218497001574	Site of frameshift mutation in CAB356 and homopolymeric tract 7x T residues
218497001575	Integral membrane protein CcmA involved in cell shape determination [Cell envelope biogenesis, outer membrane]; Region: CcmA; COG1664
218497001576	chromosomal replication initiation protein; Reviewed; Region: dnaA; PRK00149
218497001577	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497001578	Walker A motif; other site
218497001579	ATP binding site [chemical binding]; other site
218497001580	Walker B motif; other site
218497001581	arginine finger; other site
218497001582	C-terminal domain of bacterial DnaA proteins. The DNA-binding C-terminal domain of DnaA contains a helix-turn-helix motif that specifically interacts with the DnaA box, a 9-mer motif that occurs repetitively in the replication origin oriC. Multiple...; Region: Bac_DnaA_C; cd06571
218497001583	DnaA box-binding interface [nucleotide binding]; other site
218497001584	Pfam match to entry PF00308 bac_dnaA, Bacterial dnaA protein , score 491.4, E-value 4.6e-145
218497001585	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001586	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497001587	TPR motif; other site
218497001588	binding surface
218497001589	Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane]; Region: COG0275
218497001590	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl12011
218497001591	Pfam match to entry PF01795 Methyltransf_5, MraW methylase , score 507.9, E-value 5.1e-150
218497001592	Cell division protein FtsI/penicillin-binding protein 2 [Cell envelope biogenesis, outer membrane]; Region: FtsI; COG0768
218497001593	Penicillin-binding Protein dimerisation domain; Region: PBP_dimer; pfam03717
218497001594	Penicillin binding protein transpeptidase domain; Region: Transpeptidase; cl01009
218497001595	1 probable transmembrane helix predicted for CAB362 by TMHMM2.0 at aa 7-26
218497001596	Pfam match to entry PF03717 PBP_dimer, Penicillin-binding Protein dimerisation domain , score 84.7, E-value 1.2e-22
218497001597	Pfam match to entry PF00905 Transpeptidase, Penicillin binding protein transpeptidase domain , score 151.5, E-value 9.3e-43
218497001598	Similar to Chlamydophila caviae hypothetical protein cca00375 SWALL:Q823N3 (EMBL:AE016995) (147 aa) fasta scores: E(): 3.2e-32, 68.42% id in 133 aa, and to Chlamydia pneumoniae hypothetical protein cpn0221 cpn0221 or cpj0221 or cp0544 or cpb0225 SWALL:Q9Z8W3 (EMBL:AE001608) (136 aa) fasta scores: E(): 1.4e-08, 36.6% id in 112 aa. Note this CDS carries a premature stop codon following codon 53 and appears to have lost the very N-terminal region.;membrane protein (remnant)
218497001599	UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase; Provisional; Region: murE; PRK00139
218497001600	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
218497001601	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
218497001602	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
218497001603	Pfam match to entry PF01225 Mur_ligase, Mur ligase, catalytic domain , score 215.0, E-value 7.4e-62
218497001604	Pfam match to entry PF02875 Mur_ligase_C, Mur ligase, glutamate ligase domain , score 99.2, E-value 5.3e-27
218497001605	N-acetylmuramoyl-l-alanine amidase I; Provisional; Region: PRK10319
218497001606	N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA (also known as peptidoglycan aminohydrolase, NAMLA amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC 3.5.1.28) is an autolysin that hydrolyzes the amide bond between N-acetylmuramoyl and L-amino...; Region: MurNAc-LAA; cd02696
218497001607	active site
218497001608	metal binding site [ion binding]; metal-binding site
218497001609	Signal peptide predicted for CAB364 by SignalP 2.0 HMM (Signal peptide probabilty 0.988) with cleavage site probability 0.700 between residues 34 and 35
218497001610	Pfam match to entry PF01520 Amidase_3, N-acetylmuramoyl-L-alanine amidase , score 186.6, E-value 2.5e-53
218497001611	Integration host factor (IHF) and HU are small heterodimeric members of the DNABII protein family that bind and bend DNA, functioning as architectural factors in many cellular processes including transcription, site-specific recombination, and...; Region: HU_IHF; cd00591
218497001612	IHF - DNA interface [nucleotide binding]; other site
218497001613	IHF dimer interface [polypeptide binding]; other site
218497001614	Pfam match to entry PF00216 Bac_DNA_binding, Bacterial DNA-binding protein , score 121.0, E-value 1.4e-33
218497001615	acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated; Region: PRK05724
218497001616	Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit; Region: ACCA; cl00513
218497001617	Pfam match to entry PF03255 ACCA, Acetyl co-enzyme A carboxylase carboxyltransferase alpha subunit , score 317.5, E-value 1e-92
218497001618	PS00070 Aldehyde dehydrogenases cysteine active site.
218497001619	ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]; Region: MdlB; COG1132
218497001620	ABC transporter transmembrane region; Region: ABC_membrane; cl00549
218497001621	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497001622	Walker A/P-loop; other site
218497001623	ATP binding site [chemical binding]; other site
218497001624	Q-loop/lid; other site
218497001625	ABC transporter signature motif; other site
218497001626	Walker B; other site
218497001627	D-loop; other site
218497001628	H-loop/switch region; other site
218497001629	Signal peptide predicted for CAB368 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.971 between residues 34 and 35
218497001630	Pfam match to entry PF00664 ABC_membrane, ABC transporter transmembrane region , score 75.4, E-value 7.9e-20
218497001631	4 probable transmembrane helices predicted for CAB368 by TMHMM2.0 at aa 120-142, 199-221, 225-244 and 312-334
218497001632	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 193.7, E-value 1.9e-55
218497001633	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001634	PS00211 ABC transporters family signature.
218497001635	Phosphorylase superfamily; Region: PNP_UDP_1; cl00303
218497001636	Tripartite tricarboxylate transporter family receptor; Region: TctC; cl15260
218497001637	Pfam match to entry PF02642 DUF191, Uncharacterized ACR, COG2107 , score 433.9, E-value 9.4e-128
218497001638	DNA polymerase III subunit epsilon; Validated; Region: PRK06309
218497001639	DEDDh 3'-5' exonuclease domain family; Region: DEDDh; cd06127
218497001640	active site
218497001641	substrate binding site [chemical binding]; other site
218497001642	catalytic site [active]
218497001643	Protein of unknown function (DUF3820); Region: DUF3820; cl01411
218497001644	Pfam match to entry PF00929 Exonuclease, Exonuclease , score 157.0, E-value 2.1e-44
218497001645	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
218497001646	Family of unknown function (DUF1790); Region: DUF1790; cl02283
218497001647	Flagellar biosynthesis protein, FliO; Region: FliO; cl01247
218497001648	1 probable transmembrane helix predicted for CAB373 by TMHMM2.0 at aa 27-49
218497001649	Predicted hydrolases of the HAD superfamily [General function prediction only]; Region: Cof; COG0561
218497001650	Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl11391
218497001651	active site
218497001652	motif I; other site
218497001653	motif II; other site
218497001654	Enoyl-[acyl-carrier-protein]; Region: FabI; COG0623
218497001655	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497001656	NAD(P) binding site [chemical binding]; other site
218497001657	active site
218497001658	Pfam match to entry PF00106 adh_short, short chain dehydrogenase , score -7.0, E-value 4.7e-07
218497001659	Similar to Chlamydophila caviae conserved hypothetical protein cca00390 SWALL:Q823L9 (EMBL:AE016995) (898 aa) fasta scores: E(): 2.2e-91, 46.97% id in 645 aa. This CDS carries a frameshift following codon 544 and premature stop codons. Note rich in the aa Leu and Ser;conserved hypothetical protein (pseudogene)
218497001660	Pseudouridylate synthases, 23S RNA-specific [Translation, ribosomal structure and biogenesis]; Region: RluA; COG0564
218497001661	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
218497001662	RNA binding surface [nucleotide binding]; other site
218497001663	PseudoU_synth_RsuA/RluD: Pseudouridine synthase, RsuA/RluD family. This group is comprised of eukaryotic, bacterial and archeal proteins similar to eight site specific Escherichia coli pseudouridine synthases: RsuA, RluA, RluB, RluC, RluD, RluE, RluF and...; Region: PseudoU_synth_RluCD_like; cd02869
218497001664	active site
218497001665	Pfam match to entry PF00849 PseudoU_synth_2, RNA pseudouridylate synthase , score 154.7, E-value 1e-43
218497001666	PS01129 Rlu family of pseudouridine synthase signature.
218497001667	Pfam match to entry PF01479 S4, S4 domain , score 28.4, E-value 1.1e-05
218497001668	A/G-specific DNA glycosylase [DNA replication, recombination, and repair]; Region: MutY; COG1194
218497001669	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
218497001670	minor groove reading motif; other site
218497001671	helix-hairpin-helix signature motif; other site
218497001672	substrate binding pocket [chemical binding]; other site
218497001673	active site
218497001674	DNA glycosylase (MutY in bacteria and hMYH in humans) is responsible for repairing misread  A*oxoG residues to C*G by removing the inappropriately paired adenine base from the DNA backbone. It belongs to the Nudix hydrolase superfamily and is important...; Region: DNA_Glycosylase_C; cd03431
218497001675	DNA binding and oxoG recognition site [nucleotide binding]
218497001676	Pfam match to entry PF00730 HhH-GPD, HhH-GPD superfamily base excision DNA repair protein , score 203.2, E-value 2.6e-58
218497001677	MazG nucleotide pyrophosphohydrolase domain; Region: MazG; cl00345
218497001678	CAAX amino terminal protease self- immunity; Region: Abi; cl00558
218497001679	Pfam match to entry PF02517 Abi, CAAX amino terminal protease , score 106.6, E-value 3e-29
218497001680	6 probable transmembrane helices predicted for CAB382 by TMHMM2.0 at aa 5-24, 36-55, 70-92, 113-135, 160-182 and 194-211
218497001681	Signal peptide predicted for CAB382 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.436 between residues 24 and 25
218497001682	Signal peptide predicted for CAB383 by SignalP 2.0 HMM (Signal peptide probabilty 0.920) with cleavage site probability 0.337 between residues 51 and 52
218497001683	Similar to several Chlamydiaceae proteins including: Chlamydophila caviae hypothetical protein cca00645 SWALL:Q822N6 (EMBL:AE016996) (132 aa) fasta scores: E(): 3.2, 26.08% id in 138 aa, and to Chlamydia pneumoniae ct058 hypothetical protein cpn0370 or cpj0370 or cp0387 or cpb0382 SWALL:Q9Z8H3 (EMBL:AE001621) (371 aa) fasta scores: E(): 9.2, 23.74% id in 139 aa. Note this CDS appears to have a frameshift mutation following codon 102 which occurs in a homopolymeric tract(9x G). This leaves open the possibility that the expression of its protein product may be subject to phase variation.; conserved membrane protein (pseudogene)
218497001684	9 x poly G tract
218497001685	Similar to Chlamydophila caviae hypothetical protein cca00397 SWALL:Q823L3 (EMBL:AE016995) (121 aa) fasta scores: E(): 5.1e-17, 53.6% id in 125 aa. Note the premature stop codon within the sequence.; conserved membrane protein (pseudogene)
218497001686	1 probable transmembrane helix predicted for CAB384 by TMHMM2.0 at aa 38-60
218497001687	Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly...; Region: Macro; cl00019
218497001688	2 probable transmembrane helices predicted for CAB385 by TMHMM2.0 at aa 2-21 and 25-47
218497001689	Signal peptide predicted for CAB385 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.546 between residues 21 and 22
218497001690	Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence...; Region: PP2Cc; cd00143
218497001691	active site
218497001692	Pfam match to entry PF00481 PP2C, Protein phosphatase 2C , score -22.9, E-value 6.6e-06
218497001693	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
218497001694	cysteine desulfurase DndA; Region: DNA_S_dndA; TIGR03235
218497001695	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
218497001696	catalytic residue [active]
218497001697	Pfam match to entry PF00266 aminotran_5, Aminotransferase class-V , score 109.9, E-value 3.2e-30
218497001698	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
218497001699	Domain of unknown function DUF21; Region: DUF21; pfam01595
218497001700	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
218497001701	Transporter associated domain; Region: CorC_HlyC; cl08393
218497001702	Pfam match to entry PF03471 CorC_HlyC, Transporter associated domain , score 63.1, E-value 3.8e-16
218497001703	Pfam match to entry PF00571 CBS, CBS domain , score 21.2, E-value 0.0016
218497001704	Pfam match to entry PF00571 CBS, CBS domain , score 13.2, E-value 0.07
218497001705	Pfam match to entry PF01595 DUF21, Domain of unknown function DUF21 , score 30.1, E-value 2.3e-07
218497001706	4 probable transmembrane helices predicted for CAB388 by TMHMM2.0 at aa 10-32, 53-75, 95-114 and 121-143
218497001707	Hemolysins and related proteins containing CBS domains [General function prediction only]; Region: TlyC; COG1253
218497001708	Domain of unknown function DUF21; Region: DUF21; pfam01595
218497001709	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain. CorC_HlyC is a transporter associated domain. This small domain is found in Na+/H+ antiporters, in proteins involved in...; Region: CBS_pair_CorC_HlyC_assoc; cd04590
218497001710	Transporter associated domain; Region: CorC_HlyC; cl08393
218497001711	Pfam match to entry PF03471 CorC_HlyC, Transporter associated domain , score 85.2, E-value 8.4e-23
218497001712	Pfam match to entry PF00571 CBS, CBS domain , score 20.6, E-value 0.0024
218497001713	Pfam match to entry PF00571 CBS, CBS domain , score 31.7, E-value 1.1e-06
218497001714	Pfam match to entry PF01595 DUF21, Domain of unknown function DUF21 , score 75.5, E-value 7.1e-20
218497001715	3 probable transmembrane helices predicted for CAB389 by TMHMM2.0 at aa 5-27, 60-82 and 89-111
218497001716	Signal peptide predicted for CAB389 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.848 between residues 23 and 24
218497001717	E2 (early) protein, N terminal; Region: PPV_E2_N; pfam00508
218497001718	1 probable transmembrane helix predicted for CAB390 by TMHMM2.0 at aa 13-35
218497001719	Trimeric dUTP diphosphatases; Region: trimeric_dUTPase; cd07557
218497001720	trimer interface [polypeptide binding]; other site
218497001721	active site
218497001722	Pfam match to entry PF00692 dUTPase, dUTPase , score -7.5, E-value 0.0011
218497001723	Holliday junction DNA helicase RuvB; Reviewed; Region: ruvB; PRK00080
218497001724	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497001725	Walker A motif; other site
218497001726	ATP binding site [chemical binding]; other site
218497001727	Walker B motif; other site
218497001728	arginine finger; other site
218497001729	Holliday junction DNA helicase ruvB C-terminus; Region: RuvB_C; pfam05491
218497001730	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 111.0, E-value 1.5e-30
218497001731	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001732	SpoIID/LytB domain; Region: SpoIID_LytB; TIGR02669
218497001733	Signal peptide predicted for CAB393 by SignalP 2.0 HMM (Signal peptide probabilty 0.938) with cleavage site probability 0.571 between residues 19 and 20
218497001734	Type II secretory pathway, pullulanase PulA and related glycosidases [Carbohydrate transport and metabolism]; Region: PulA; COG1523
218497001735	N-terminal Early set domain associated with the catalytic domain of Glycogen debranching enzyme and bacterial isoamylase (also called glycogen 6-glucanohydrolase); Region: E_set_GDE_Isoamylase_N; cd02856
218497001736	Alpha amylase, catalytic domain; Region: Alpha-amylase; cl07893
218497001737	Pfam match to entry PF00128 alpha-amylase, Alpha amylase, catalytic domain , score 89.5, E-value 4.4e-24
218497001738	Pfam match to entry PF02922 isoamylase_N, Isoamylase N-terminal domain , score 83.3, E-value 3.2e-22
218497001739	Tir chaperone protein (CesT); Region: CesT; cl08444
218497001740	SSB_OBF: A subfamily of OB folds similar to the OB fold of ssDNA-binding protein (SSB). SSBs bind with high affinity to ssDNA. They bind to and protect ssDNA intermediates during DNA metabolic pathways. All bacterial and eukaryotic SSBs studied to date...; Region: SSB_OBF; cd04496
218497001741	dimer interface [polypeptide binding]; other site
218497001742	ssDNA binding site [nucleotide binding]; other site
218497001743	tetramer (dimer of dimers) interface [polypeptide binding]; other site
218497001744	Pfam match to entry PF00436 SSB, Single-strand binding protein family , score 89.5, E-value 4.4e-24
218497001745	multifunctional aminopeptidase A; Provisional; Region: PRK00913
218497001746	Cytosol aminopeptidase family, N-terminal and catalytic domains.  Family M17 contains zinc- and manganese-dependent exopeptidases ( EC  3.4.11.1), including leucine aminopeptidase. They catalyze removal of amino acids from the N-terminus of a protein and...; Region: Peptidase_M17; cd00433
218497001747	interface (dimer of trimers) [polypeptide binding]; other site
218497001748	Substrate-binding/catalytic site; other site
218497001749	Zn-binding sites [ion binding]; other site
218497001750	Pfam match to entry PF02789 Peptidase_M17_N, Cytosol aminopeptidase, N-terminal domain , score -5.1, E-value 0.014
218497001751	Pfam match to entry PF00883 Peptidase_M17, Cytosol aminopeptidase, catalytic domain , score 487.1, E-value 8.9e-144
218497001752	Histone H1-like nucleoprotein HC2; Region: HC2; pfam07382
218497001753	hypothetical protein; Provisional; Region: PRK05907
218497001754	Predicted helix-turn-helix motif with score 1086.000, SD 2.89 at aa 41-62, sequence SGKAQEMDALGLTISDLSQWTE
218497001755	Predicted methyltransferases [General function prediction only]; Region: COG0313
218497001756	Tetrapyrrole (Corrin/Porphyrin) Methylases; Region: TP_methylase; cl00304
218497001757	Pfam match to entry PF00590 TP_methylase, Tetrapyrrole (Corrin/Porphyrin) Methylases , score -37.8, E-value 0.0027
218497001758	3 probable transmembrane helices predicted for CAB401 by TMHMM2.0 at aa 10-31, 51-73 and 93-115
218497001759	coproporphyrinogen III oxidase; Provisional; Region: PRK06294
218497001760	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497001761	FeS/SAM binding site; other site
218497001762	HemN C-terminal region; Region: HemN_C; pfam06969
218497001763	Pfam match to entry PF02473 Coprogen_an_ox, Oxygen-independent Coproporphyrinogen III oxidase , score -61.9, E-value 2.8e-11
218497001764	Protein of unknown function (DUF342); Region: DUF342; pfam03961
218497001765	2-oxoglutarate dehydrogenase E1 component; Reviewed; Region: sucA; PRK09404
218497001766	Thiamine pyrophosphate (TPP) family, E1 of OGDC-like subfamily, TPP-binding module; composed of proteins similar to the E1 component of the 2-oxoglutarate dehydrogenase multienzyme complex (OGDC). OGDC catalyzes the oxidative decarboxylation of...; Region: TPP_E1_OGDC_like; cd02016
218497001767	TPP-binding site [chemical binding]; other site
218497001768	Pyrimidine (PYR) binding domain of thiamine pyrophosphate (TPP)-dependent enzymes; Region: TPP_enzyme_PYR; cl11410
218497001769	Pfam match to entry PF00676 E1_dehydrog, Dehydrogenase E1 component , score 127.4, E-value 1.7e-35
218497001770	Pfam match to entry PF02779 transket_pyr, Transketolase, pyridine binding domain , score 201.5, E-value 8.6e-58
218497001771	dihydrolipoamide succinyltransferase; Validated; Region: PRK05704
218497001772	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
218497001773	E3 interaction surface; other site
218497001774	lipoyl attachment site [posttranslational modification]; other site
218497001775	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; cl02008
218497001776	Pfam match to entry PF00364 biotin_lipoyl, Biotin-requiring enzyme , score 39.3, E-value 5.8e-09
218497001777	Pfam match to entry PF00198 2-oxoacid_dh, 2-oxo acid dehydrogenases acyltransferase (catalytic domain) , score 423.7, E-value 1.1e-124
218497001778	Multi-copper polyphenol oxidoreductase laccase; Region: Cu-oxidase_4; cl00650
218497001779	Pfam match to entry PF02578 DUF152, Uncharacterized ACR, YfiH family COG1496 , score 281.4, E-value 7.3e-82
218497001780	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Validated; Region: PRK00694; cl15446
218497001781	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase; Provisional; Region: PRK02048
218497001782	2 probable transmembrane helices predicted for CAB410 by TMHMM2.0 at aa 49-71 and 76-98
218497001783	Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly...; Region: Macro; cd02749
218497001784	ADP-ribose binding site [chemical binding]; other site
218497001785	2 probable transmembrane helices predicted for CAB411 by TMHMM2.0 at aa 47-69 and 73-95
218497001786	Macro domain, a high-affinity ADP-ribose binding module found in a variety of proteins as a stand-alone domain or in combination with other domains like in histone macroH2A and some PARPs (poly ADP-ribose polymerases). Some macro domains recognize poly...; Region: Macro; cd02749
218497001787	ADP-ribose binding site [chemical binding]; other site
218497001788	2 probable transmembrane helices predicted for CAB412 by TMHMM2.0 at aa 33-55 and 59-78
218497001789	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
218497001790	catalytic loop [active]
218497001791	iron binding site [ion binding]; other site
218497001792	Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur cluster binding domain , score 50.9, E-value 1.8e-12
218497001793	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
218497001794	flagellar biosynthesis protein FlhA; Validated; Region: flhA; cl07980
218497001795	7 probable transmembrane helices predicted for CAB414 by TMHMM2.0 at aa 9-26, 30-52, 64-86, 101-123, 191-213, 228-250 and 275-297
218497001796	Pfam match to entry PF00771 FHIPEP, FHIPEP family , score 494.2, E-value 6.4e-146
218497001797	RNA polymerase sigma factor sigma-28; Reviewed; Region: PRK05911
218497001798	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
218497001799	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
218497001800	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
218497001801	DNA binding residues [nucleotide binding]
218497001802	Predicted helix-turn-helix motif with score 1024.000, SD 2.67 at aa 222-148, sequence ASARPALIISLNEERPSLSDGESGVALEERIADERAETGYDIVDKKEFSSFLASAIE SLEEKERKVMALYYYEEL
218497001803	probable transmembrane helices predicted for CAB416 by TMHMM2.0 at aa 57-79
218497001804	Signal peptide predicted for CAB416 by SignalP 2.0 HMM (Signal peptide probabilty 0.990) with cleavage site probability 0.936 between residues 50 and 51
218497001805	tyrosyl-tRNA synthetase; Validated; Region: PRK05912
218497001806	catalytic core domain of tyrosinyl-tRNA synthetase; Region: TyrRS_core; cd00805
218497001807	active site
218497001808	HIGH motif; other site
218497001809	dimer interface [polypeptide binding]; other site
218497001810	KMSKS motif; other site
218497001811	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cl09940
218497001812	Pfam match to entry PF00579 tRNA-synt_1b, tRNA synthetases class I (W and Y) , score 339.8, E-value 2e-99
218497001813	Pfam match to entry PF01479 S4, S4 domain , score 38.0, E-value 1.4e-08
218497001814	6-phosphogluconate dehydrogenase, decarboxylating; Region: gnd; TIGR00873
218497001815	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497001816	6-phosphogluconate dehydrogenase, C-terminal domain; Region: 6PGD; pfam00393
218497001817	Pfam match to entry PF03446 NAD_binding_2, NAD binding domain of 6-phosphogluconate dehydrogenase , score 400.1, E-value 1.4e-117
218497001818	Pfam match to entry PF00393 6PGD, 6-phosphogluconate dehydrogenase, C-terminal domain , score 505.7, E-value 2.3e-149
218497001819	PS00461 6-phosphogluconate dehydrogenase signature.
218497001820	GTP-binding protein LepA; Provisional; Region: PRK05433
218497001821	LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and...; Region: LepA; cd01890
218497001822	G1 box; other site
218497001823	putative GEF interaction site [polypeptide binding]; other site
218497001824	GTP/Mg2+ binding site [chemical binding]; other site
218497001825	Switch I region; other site
218497001826	G2 box; other site
218497001827	G3 box; other site
218497001828	Switch II region; other site
218497001829	G4 box; other site
218497001830	G5 box; other site
218497001831	lepA_II: This subfamily represents the domain II of LepA, a GTP-binding protein localized in the cytoplasmic membrane. The N-terminal domain of LepA shares regions of homology to translation factors. In terms of interaction with the ribosome, EF-G, EF-Tu...; Region: lepA_II; cd03699
218497001832	lepA_C: This family represents the C-terminal region of LepA, a GTP-binding protein localized in the cytoplasmic membrane.   LepA is ubiquitous in Bacteria and Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is missing from Archaea. LepA exhibits...; Region: lepA_C; cd03709
218497001833	GTP-binding protein LepA C-terminus; Region: LepA_C; pfam06421
218497001834	Pfam match to entry PF00679 EFG_C, Elongation factor G C-terminus , score 112.5, E-value 5.1e-31
218497001835	Pfam match to entry PF03144 GTP_EFTU_D2, Elongation factor Tu domain 2 , score 72.0, E-value 7.9e-19
218497001836	Pfam match to entry PF00009 GTP_EFTU, Elongation factor Tu GTP binding domain , score 248.6, E-value 5.5e-72
218497001837	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001838	Protein of unknown function (DUF1389); Region: DUF1389; pfam07146
218497001839	2 probable transmembrane helices predicted for CAB420 by TMHMM2.0 at aa 31-53 and 60-82
218497001840	TLC ATP/ADP transporter; Region: TLC; cl03940
218497001841	Pfam match to entry PF03219 TLC, TLC ATP/ADP transporter , score 1124.4, E-value 0
218497001842	11 probable transmembrane helices predicted for CAB421 by TMHMM2.0 at aa 27-44, 59-81, 94-116, 149-171, 184-206, 221-243, 285-307, 327-345, 352-374, 384-406 and 462-484
218497001843	PS00430 TonB-dependent receptor proteins signature 1.
218497001844	putative arabinose transporter; Provisional; Region: PRK03545
218497001845	Helical backbone metal receptor (TroA-like domain). These proteins have been shown to function in the ABC transport of ferric siderophores and metal ions such as Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site is formed in the interface between...; Region: TroA-like; cl00262
218497001846	Periplasmic solute binding protein family; Region: SBP_bac_9; pfam01297
218497001847	intersubunit interface [polypeptide binding]; other site
218497001848	Signal peptide predicted for CAB423 by SignalP 2.0 HMM (Signal peptide probabilty 0.996) with cleavage site probability 0.428 between residues 32 and 33
218497001849	Pfam match to entry PF01297 SBP_bac_9, Periplasmic solute binding protein family , score 366.2, E-value 2.2e-107
218497001850	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497001851	ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]; Region: ZnuC; COG1121
218497001852	ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of...; Region: ABC_Metallic_Cations; cd03235
218497001853	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 158.2, E-value 9.1e-45
218497001854	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001855	PS00211 ABC transporters family signature.
218497001856	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
218497001857	ABC-ATPase subunit  interface; other site
218497001858	dimer interface [polypeptide binding]; other site
218497001859	putative PBP binding regions; other site
218497001860	Helix-turn-helix diphteria tox regulatory element; Region: HTH_DTXR; smart00529
218497001861	Iron dependent repressor, metal binding and dimerisation domain; Region: Fe_dep_repr_C; pfam02742
218497001862	Signal peptide predicted for CAB425 by SignalP 2.0 HMM (Signal peptide probabilty 0.828) with cleavage site probability 0.519 between residues 29 and 30
218497001863	Pfam match to entry PF00950 ABC-3, ABC 3 transport family , score 46.5, E-value 1.1e-12
218497001864	6 probable transmembrane helices predicted for CAB425 by TMHMM2.0 at aa 68-90, 102-120, 143-165, 190-212, 232-254 and 266-288
218497001865	Pfam match to entry PF02742 Fe_dep_repr_C, Iron dependent repressor, metal binding and dimerisation domain , score 59.3, E-value 5.5e-15
218497001866	Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+. PBP-dependent ABC transporters consist of...; Region: TM_ABC_iron-siderophores_like; cd06550
218497001867	ABC-ATPase subunit  interface; other site
218497001868	dimer interface [polypeptide binding]; other site
218497001869	putative PBP binding regions; other site
218497001870	Pfam match to entry PF00950 ABC-3, ABC 3 transport family , score 12.6, E-value 4.7e-11
218497001871	9 probable transmembrane helices predicted for CAB426 by TMHMM2.0 at aa 39-61, 66-88, 92-114, 127-144, 167-189, 196-218, 228-250, 255-277 and 281-303
218497001872	1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional; Region: PRK05447
218497001873	1-deoxy-D-xylulose 5-phosphate reductoisomerase; Region: DXP_reductoisom; pfam02670
218497001874	1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal; Region: DXP_redisom_C; pfam08436
218497001875	Signal peptide predicted for CAB427 by SignalP 2.0 HMM (Signal peptide probabilty 0.775) with cleavage site probability 0.733 between residues 19 and 20
218497001876	Pfam match to entry PF02670 DXP_reductoisom, 1-deoxy-D-xylulose 5-phosphate reductoisomerase , score 690.7, E-value 4.7e-205
218497001877	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001878	RseP-like Site-2 proteases (S2P), zinc metalloproteases (MEROPS family M50A), cleave transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. In Escherichia coli, the S2P homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163
218497001879	RIP metalloprotease RseP; Region: TIGR00054
218497001880	RIP metalloprotease RseP; Region: TIGR00054
218497001881	PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif). Many PDZ domains bind C-terminal polypeptides, though binding to internal (non-C-terminal) polypeptides and even to lipids has been demonstrated; Region: PDZ; cl00117
218497001882	Site-2 protease (S2P) class of zinc metalloproteases (MEROPS family M50) cleaves transmembrane domains of substrate proteins, regulating intramembrane proteolysis (RIP) of diverse signal transduction mechanisms. Members of this family use proteolytic...; Region: S2P-M50; cl10020
218497001883	putative substrate binding region [chemical binding]; other site
218497001884	Signal peptide predicted for CAB428 by SignalP 2.0 HMM (Signal peptide probabilty 0.939) with cleavage site probability 0.399 between residues 19 and 20
218497001885	PS00142 Neutral zinc metallopeptidases, zinc-binding region signature.
218497001886	3 probable transmembrane helices predicted for CAB428 by TMHMM2.0 at aa 102-124, 557-579 and 591-613
218497001887	Alpha/beta hydrolase family; Region: Abhydrolase_5; pfam12695
218497001888	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cl12031
218497001889	Signal peptide predicted for CAB429 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.901 between residues 21 and 22
218497001890	Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]; Region: RecF; COG1195
218497001891	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497001892	Walker A/P-loop; other site
218497001893	ATP binding site [chemical binding]; other site
218497001894	Q-loop/lid; other site
218497001895	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497001896	ABC transporter signature motif; other site
218497001897	Walker B; other site
218497001898	D-loop; other site
218497001899	H-loop/switch region; other site
218497001900	Predicted helix-turn-helix motif with score 1198.000, SD 3.27 at aa 342-363, sequence QTLSEANRIFSVNQAQISIHSH
218497001901	Pfam match to entry PF02463 SMC_N, RecF/RecN/SMC N terminal domain , score -10.7, E-value 8.4e-07
218497001902	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001903	DNA polymerase III subunit beta; Validated; Region: PRK05643
218497001904	Beta clamp domain.  The beta subunit (processivity factor) of DNA polymerase III holoenzyme, refered to as the beta clamp, forms a ring shaped dimer that encircles dsDNA (sliding clamp) in bacteria.  The beta-clamp is structurally similar to the trimeric...; Region: beta_clamp; cd00140
218497001905	putative DNA binding surface [nucleotide binding]; other site
218497001906	dimer interface [polypeptide binding]; other site
218497001907	beta-clamp/clamp loader binding surface; other site
218497001908	beta-clamp/translesion DNA polymerase binding surface; other site
218497001909	Pfam match to entry PF02768 DNA_pol3_beta_3, DNA polymerase III beta subunit, C-terminal domain , score 39.2, E-value 6.1e-09
218497001910	Pfam match to entry PF02767 DNA_pol3_beta_2, DNA polymerase III beta subunit, central domain , score 99.3, E-value 4.9e-27
218497001911	Pfam match to entry PF00712 DNA_pol3_beta, DNA polymerase III beta subunit, N-terminal domain , score 67.3, E-value 2.1e-17
218497001912	Small protein B (SmpB) is a component of the trans-translation system in prokaryotes for releasing stalled ribosome from damaged messenger RNAs; Region: SmpB; cd09294
218497001913	SmpB-tmRNA interface; other site
218497001914	Pfam match to entry PF01668 SmpB, SmpB protein , score 111.6, E-value 1e-30
218497001915	PS01317 Protein smpB signature.
218497001916	ApbE family; Region: ApbE; cl00643
218497001917	Pfam match to entry PF02424 ApbE, ApbE family , score 388.8, E-value 3.5e-114
218497001918	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497001919	Signal peptide predicted for CAB433 by SignalP 2.0 HMM (Signal peptide probabilty 0.737) with cleavage site probability 0.520 between residues 19 and 20
218497001920	bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional; Region: PRK14181
218497001921	Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain; Region: THF_DHG_CYH; pfam00763
218497001922	NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase; Region: NAD_bind_m-THF_DH_Cyclohyd; cd01080
218497001923	homodimer interface [polypeptide binding]; other site
218497001924	NADP binding site [chemical binding]; other site
218497001925	substrate binding site [chemical binding]; other site
218497001926	Pfam match to entry PF02882 THF_DHG_CYH_C, Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain , score 367.3, E-value 1e-107
218497001927	PS00767 Tetrahydrofolate dehydrogenase/cyclohydrolase signature 2.
218497001928	Pfam match to entry PF00763 THF_DHG_CYH, Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain , score 202.6, E-value 3.9e-58
218497001929	4 probable transmembrane helices predicted for CAB435 by TMHMM2.0 at aa 13-35, 50-72, 93-115 and 137-159
218497001930	Catalytic domain of phospholipase D superfamily proteins; Region: PLDc_SF; cl15239
218497001931	putative active site [active]
218497001932	catalytic site [active]
218497001933	Catalytic domain of EDTA-resistant nuclease Nuc, vertebrate phospholipase D6, and similar proteins; Region: PLDc_Nuc_like; cd09116
218497001934	putative active site [active]
218497001935	catalytic site [active]
218497001936	Pfam match to entry PF00614 PLDc, Phospholipase D. Active site motif , score 5.5, E-value 0.78
218497001937	Pfam match to entry PF00614 PLDc, Phospholipase D. Active site motif , score 18.6, E-value 0.0094
218497001938	Signal peptide predicted for CAB439 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.782 between residues 27 and 28
218497001939	3-octaprenyl-4-hydroxybenzoate carboxy-lyase; Region: UbiD; cl00311
218497001940	Pfam match to entry PF01977 UPF0096, VdcC family , score 675.7, E-value 1.5e-200
218497001941	Ribosomal L28 family; Region: Ribosomal_L28; cl00367
218497001942	Pfam match to entry PF00830 Ribosomal_L28, Ribosomal L28 family , score 40.5, E-value 2.5e-09
218497001943	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001944	4-alpha-glucanotransferase; Region: Glyco_hydro_77; cl00711
218497001945	Pfam match to entry PF02446 4A_glucanotrans, 4-alpha-glucanotransferase , score 857.8, E-value 2.3e-255
218497001946	Tir chaperone protein (CesT); Region: CesT; cl08444
218497001947	HrpJ-like domain; Region: HrpJ; cl15454
218497001948	Type III secretory pathway, component EscV [Intracellular trafficking and secretion]; Region: EscV; COG4789
218497001949	flagellar biosynthesis protein FlhA; Validated; Region: flhA; cl07980
218497001950	Pfam match to entry PF00771 FHIPEP, FHIPEP family , score 1214.0, E-value 0
218497001951	6 probable transmembrane helices predicted for CAB445 by TMHMM2.0 at aa 27-49, 64-86, 119-141, 209-231, 244-266 and 309-331
218497001952	Flagellar biosynthesis pathway, component FlhB [Cell motility and secretion / Intracellular trafficking and secretion]; Region: FlhB; cl12017
218497001953	FlhB HrpN YscU SpaS Family; Region: Bac_export_2; pfam01312
218497001954	Pfam match to entry PF01312 Bac_export_2, FlhB HrpN YscU SpaS Family , score 588.4, E-value 2.8e-174
218497001955	5 probable transmembrane helices predicted for CAB446 by TMHMM2.0 at aa 27-49, 93-115, 136-158, 163-180 and 187-206
218497001956	GTP-binding protein YchF; Reviewed; Region: PRK09601
218497001957	YchF subfamily.  YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1.  Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated...; Region: YchF; cd01900
218497001958	G1 box; other site
218497001959	GTP/Mg2+ binding site [chemical binding]; other site
218497001960	Switch I region; other site
218497001961	G2 box; other site
218497001962	Switch II region; other site
218497001963	G3 box; other site
218497001964	G4 box; other site
218497001965	G5 box; other site
218497001966	TGS_YchF_C: This subfamily represents TGS domain-containing YchF GTP-binding protein, a universally conserved GTPase whose function is unknown. The N-terminal domain of the YchF protein belongs to the Obg-like family of GTPases, and some members of the...; Region: TGS_YchF_C; cd04867
218497001967	Pfam match to entry PF01018 GTP1_OBG, GTP1/OBG family , score 7.7, E-value 0.029
218497001968	PS00017 ATP/GTP-binding site motif A (P-loop).
218497001969	Pfam match to entry PF01018 GTP1_OBG, GTP1/OBG family , score 6.6, E-value 0.06
218497001970	bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed; Region: PRK05627
218497001971	FAD synthetase, N-terminal domain of the bifunctional enzyme; Region: FAD_synthetase_N; cd02064
218497001972	active site
218497001973	Riboflavin kinase; Region: Flavokinase; cl03312
218497001974	Pfam match to entry PF01687 FAD_Synth, Riboflavin kinase / FAD synthetase , score 101.5, E-value 1.1e-27
218497001975	PseudoU_synth_EcTruB: Pseudouridine synthase, Escherichia coli TruB like. This group consists of bacterial pseudouridine synthases similar to E. coli TruB and Mycobacterium tuberculosis TruB. Pseudouridine synthases catalyze the isomerization of specific...; Region: PseudoU_synth_EcTruB; cd02573
218497001976	RNA binding site [nucleotide binding]; other site
218497001977	active site
218497001978	Pfam match to entry PF01509 TruB_N, TruB family pseudouridylate synthase (N terminal domain) , score 180.5, E-value 1.8e-51
218497001979	Ribosome-binding factor A; Region: RBFA; cl00542
218497001980	Pfam match to entry PF02033 RBFA, Ribosome-binding factor A , score 40.3, E-value 2.8e-09
218497001981	translation initiation factor IF-2; Region: IF-2; TIGR00487
218497001982	Translation initiation factor IF-2, N-terminal region; Region: IF2_N; pfam04760
218497001983	IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases; Region: IF2_eIF5B; cd01887
218497001984	G1 box; other site
218497001985	putative GEF interaction site [polypeptide binding]; other site
218497001986	GTP/Mg2+ binding site [chemical binding]; other site
218497001987	Switch I region; other site
218497001988	G2 box; other site
218497001989	G3 box; other site
218497001990	Switch II region; other site
218497001991	G4 box; other site
218497001992	G5 box; other site
218497001993	This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell; Region: IF2_mtIF2_II; cd03702
218497001994	Translation-initiation factor 2; Region: IF-2; pfam11987
218497001995	mtIF2_IVc: this family represents the C2 subdomain of domain IV of mitochondrial translation initiation factor 2 (mtIF2) which adopts a beta-barrel fold displaying a high degree of structural similarity with domain II of the translation elongation factor...; Region: mtIF2_IVc; cd03692
218497001996	Pfam match to entry PF03144 GTP_EFTU_D2, Elongation factor Tu domain 2 , score 43.5, E-value 3.1e-10
218497001997	PS01176 Initiation factor 2 signature.
218497001998	Pfam match to entry PF03144 GTP_EFTU_D2, Elongation factor Tu domain 2 , score 52.9, E-value 4.6e-13
218497001999	Pfam match to entry PF00009 GTP_EFTU, Elongation factor Tu GTP binding domain , score 173.3, E-value 2.6e-49
218497002000	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002001	transcription termination factor NusA; Region: NusA; TIGR01953
218497002002	NusA N-terminal domain; Region: NusA_N; pfam08529
218497002003	S1_NusA: N-utilizing substance A protein (NusA), S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. NusA is a transcription elongation factor containing an N-terminal catalytic domain and three...; Region: S1_NusA; cd04455
218497002004	RNA binding site [nucleotide binding]; other site
218497002005	homodimer interface [polypeptide binding]; other site
218497002006	K homology RNA-binding domain, type I.  KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA. There are two different KH domains that...; Region: KH-I; cl00098
218497002007	G-X-X-G motif; other site
218497002008	NusA_K homology RNA-binding domain (KH). NusA is an essential multifunctional transcription elongation factor that is universally conserved among prokaryotes and archaea. NusA anti-termination function plays an important role in the expression of...; Region: NusA_KH; cd02134
218497002009	G-X-X-G motif; other site
218497002010	DNA repair protein RAD51 homolog; Provisional; Region: PLN03186
218497002011	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 22.7, E-value 7.1e-06
218497002012	ribosomal protein S1; Region: rpsA; TIGR00717
218497002013	S1_RPS1_repeat_ec1_hs1: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists...; Region: S1_RPS1_repeat_ec1_hs1; cd05687
218497002014	RNA binding site [nucleotide binding]; other site
218497002015	S1_RPS1_repeat_ec2_hs2: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists...; Region: S1_RPS1_repeat_ec2_hs2; cd04465
218497002016	RNA binding site [nucleotide binding]; other site
218497002017	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
218497002018	RNA binding site [nucleotide binding]; other site
218497002019	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
218497002020	RNA binding site [nucleotide binding]; other site
218497002021	S1_RPS1_repeat_ec5: Ribosomal protein S1 (RPS1) domain. RPS1 is a component of the small ribosomal subunit thought to be involved in the recognition and binding of mRNA's during translation initiation. The bacterial RPS1 domain architecture consists of...; Region: S1_RPS1_repeat_ec5; cd05690
218497002022	RNA binding site [nucleotide binding]; other site
218497002023	S1_like: Ribosomal protein S1-like RNA-binding domain. Found in a wide variety of RNA-associated proteins. Originally identified in S1 ribosomal protein. This superfamily also contains the Cold Shock Domain (CSD), which is a homolog of the S1 domain; Region: S1_like; cl09927
218497002024	RNA binding site [nucleotide binding]; other site
218497002025	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 84.7, E-value 1.2e-22
218497002026	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 86.0, E-value 5.1e-23
218497002027	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 91.1, E-value 1.4e-24
218497002028	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 87.5, E-value 1.7e-23
218497002029	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 57.8, E-value 1.5e-14
218497002030	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 61.3, E-value 1.4e-15
218497002031	thioredoxin-disulfide reductase; Region: TRX_reduct; TIGR01292
218497002032	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497002033	Pfam match to entry PF00070 pyr_redox, Pyridine nucleotide-disulphide oxidoreductase , score 280.0, E-value 2e-81
218497002034	PS00573 Pyridine nucleotide-disulphide oxidoreductases class-II active site.
218497002035	4'-phosphopantetheinyl transferase superfamily; Region: ACPS; cl00500
218497002036	Pfam match to entry PF01648 ACPS, 4'-phosphopantetheinyl transferase superfamily , score 140.2, E-value 2.4e-39
218497002037	4 probable transmembrane helices predicted for CAB456 by TMHMM2.0 at aa 7-26, 41-60, 90-112 and 116-138
218497002038	Prolipoprotein diacylglyceryl transferase; Region: LGT; cl00478
218497002039	Signal peptide predicted for CAB457 by SignalP 2.0 HMM (Signal peptide probabilty 0.622) with cleavage site probability 0.538 between residues 53 and 54
218497002040	Pfam match to entry PF01790 LGT, Prolipoprotein diacylglyceryl transferase , score 228.0, E-value 8.8e-66
218497002041	6 probable transmembrane helices predicted for CAB457 by TMHMM2.0 at aa 72-94, 109-131, 138-160, 197-216, 223-245 and 260-282
218497002042	putative inner membrane protein translocase component YidC; Provisional; Region: PRK01001
218497002043	60Kd inner membrane protein; Region: 60KD_IMP; cl00489
218497002044	Signal peptide predicted for CAB458 by SignalP 2.0 HMM (Signal peptide probabilty 0.958) with cleavage site probability 0.570 between residues 24 and 25
218497002045	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002046	4 probable transmembrane helices predicted for CAB458 by TMHMM2.0 at aa 571-593, 638-660, 691-713 and 739-761
218497002047	Pfam match to entry PF02096 60KD_IMP, 60Kd inner membrane protein , score 358.5, E-value 4.7e-105
218497002048	chromosomal replication initiation protein; Provisional; Region: PRK12422
218497002049	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497002050	Walker A motif; other site
218497002051	ATP binding site [chemical binding]; other site
218497002052	Walker B motif; other site
218497002053	arginine finger; other site
218497002054	C-terminal domain of bacterial DnaA proteins. The DNA-binding C-terminal domain of DnaA contains a helix-turn-helix motif that specifically interacts with the DnaA box, a 9-mer motif that occurs repetitively in the replication origin oriC. Multiple...; Region: Bac_DnaA_C; cd06571
218497002055	DnaA box-binding interface [nucleotide binding]; other site
218497002056	Pfam match to entry PF00308 bac_dnaA, Bacterial dnaA protein , score 252.9, E-value 2.8e-73
218497002057	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002058	2 probable transmembrane helices predicted for CAB460 by TMHMM2.0 at aa 63-85 and 89-111
218497002059	This is a family of oligosaccharide phosphorylases. It includes yeast and mammalian glycogen phosphorylases, plant starch/glucan phosphorylase, as well as the maltodextrin phosphorylases of bacteria. The members of this family catalyze the breakdown of...; Region: GT1_Glycogen_Phosphorylase; cd04300
218497002060	homodimer interface [polypeptide binding]; other site
218497002061	glycogen/starch/alpha-glucan phosphorylases; Region: P_ylase; TIGR02093
218497002062	active site pocket [active]
218497002063	Pfam match to entry PF00343 phosphorylase, Carbohydrate phosphorylase , score 1411.1, E-value 0
218497002064	PS00102 Phosphorylase pyridoxal-phosphate attachment site.
218497002065	pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form; Region: PDHac_trf_mito; TIGR01349
218497002066	Lipoyl domain of the dihydrolipoyl acyltransferase component (E2) of 2-oxo acid dehydrogenases. 2-oxo acid dehydrogenase multienzyme complexes, like pyruvate dehydrogenase (PDH), 2-oxoglutarate dehydrogenase (OGDH) and branched-chain 2-oxo acid...; Region: lipoyl_domain; cd06849
218497002067	E3 interaction surface; other site
218497002068	lipoyl attachment site [posttranslational modification]; other site
218497002069	e3 binding domain; Region: E3_binding; pfam02817
218497002070	2-oxoacid dehydrogenases acyltransferase (catalytic domain); Region: 2-oxoacid_dh; cl02008
218497002071	Pfam match to entry PF00198 2-oxoacid_dh, 2-oxo acid dehydrogenases acyltransferase (catalytic domain) , score 380.9, E-value 8.4e-112
218497002072	Pfam match to entry PF02817 e3_binding, e3 binding domain , score 57.8, E-value 1.6e-14
218497002073	Pfam match to entry PF00364 biotin_lipoyl, Biotin-requiring enzyme , score 69.5, E-value 4.6e-18
218497002074	Pyruvate/2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, eukaryotic type, beta subunit [Energy production and conversion]; Region: AcoB; COG0022
218497002075	Pyrimidine (PYR) binding domain of the beta subunits of the E1 components of human pyruvate dehydrogenase complex (E1- PDHc) and related proteins; Region: TPP_PYR_E1-PDHc-beta_like; cd07036
218497002076	alpha subunit interface [polypeptide binding]; other site
218497002077	TPP binding site [chemical binding]; other site
218497002078	heterodimer interface [polypeptide binding]; other site
218497002079	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
218497002080	Pfam match to entry PF02780 transketolase_C, Transketolase, C-terminal domain , score 173.6, E-value 2.2e-49
218497002081	Pfam match to entry PF02779 transket_pyr, Transketolase, pyridine binding domain , score 258.4, E-value 6.3e-75
218497002082	pyruvate dehydrogenase E1 component, alpha subunit; Region: PDH_E1_alph_y; TIGR03182
218497002083	Thiamine pyrophosphate (TPP) family, E1 of PDC_ADC_BCADC subfamily, TPP-binding module; composed of proteins similar to the E1 components of the human pyruvate dehydrogenase complex (PDC), the acetoin dehydrogenase complex (ADC) and the branched chain...; Region: TPP_E1_PDC_ADC_BCADC; cd02000
218497002084	tetramer interface [polypeptide binding]; other site
218497002085	TPP-binding site [chemical binding]; other site
218497002086	heterodimer interface [polypeptide binding]; other site
218497002087	phosphorylation loop region [posttranslational modification]
218497002088	Pfam match to entry PF00676 E1_dehydrog, Dehydrogenase E1 component , score 253.1, E-value 2.5e-73
218497002089	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase; Provisional; Region: lpxD; PRK00892
218497002090	UDP-3-O-[3-hydroxymyristoyl] glucosamine N-acyltransferase, LpxD; Region: LpxD; pfam04613
218497002091	UDP-3-O-acyl-glucosamine N-acyltransferase (LpxD): The enzyme catalyzes the transfer of 3-hydroxymyristic acid or 3-hydroxy-arachidic acid, depending on the organism, from the acyl carrier protein (ACP) to UDP-3-O-acyl-glucosamine to produce UDP-2; Region: LbH_LpxD; cd03352
218497002092	trimer interface [polypeptide binding]; other site
218497002093	active site
218497002094	UDP-GlcNAc binding site [chemical binding]; other site
218497002095	lipid binding site [chemical binding]; lipid-binding site
218497002096	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 13.1, E-value 0.45
218497002097	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 10.8, E-value 2
218497002098	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 13.8, E-value 0.27
218497002099	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 16.7, E-value 0.035
218497002100	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 19.7, E-value 0.0046
218497002101	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 11.7, E-value 1.1
218497002102	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 12.8, E-value 0.55
218497002103	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 13.2, E-value 0.41
218497002104	Outer membrane protein [Cell envelope biogenesis, outer membrane]; Region: HlpA; COG2825
218497002105	Pfam match to entry PF03938 OmpH, Outer membrane protein (OmpH-like) , score 127.0, E-value 2.2e-35
218497002106	Signal peptide predicted for CAB467 by SignalP 2.0 HMM (Signal peptide probabilty 0.996) with cleavage site probability 0.798 between residues 23 and 24
218497002107	Outer membrane protein/protective antigen OMA87 [Cell envelope biogenesis, outer membrane]; Region: COG4775
218497002108	Surface antigen variable number repeat; Region: Surf_Ag_VNR; cl10520
218497002109	Surface antigen variable number repeat; Region: Surf_Ag_VNR; cl10520
218497002110	Surface antigen variable number repeat; Region: Surf_Ag_VNR; cl10520
218497002111	Surface antigen variable number repeat; Region: Surf_Ag_VNR; cl10520
218497002112	Surface antigen; Region: Bac_surface_Ag; cl03097
218497002113	Pfam match to entry PF01103 Bac_surface_Ag, Bacterial surface antigen , score 22.6, E-value 5.5e-08
218497002114	Pfam match to entry PF01103 Bac_surface_Ag, Bacterial surface antigen , score 53.9, E-value 8.2e-18
218497002115	Signal peptide predicted for CAB468 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.997 between residues 25 and 26
218497002116	recombination protein RecR; Reviewed; Region: recR; PRK00076
218497002117	TOPRIM_recR: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in Escherichia coli RecR.  RecR participates in the RecFOR pathway of homologous recombinational repair in prokaryotes. This pathway provides a...; Region: TOPRIM_recR; cd01025
218497002118	putative active site [active]
218497002119	putative metal-binding site [ion binding]; other site
218497002120	tetramer interface [polypeptide binding]; other site
218497002121	Pfam match to entry PF01751 Toprim, Toprim domain , score 46.2, E-value 4.8e-11
218497002122	3-oxoacyl-(acyl carrier protein) synthase III; Reviewed; Region: PRK09352
218497002123	Ketoacyl-acyl carrier protein synthase III (KASIII) initiates the elongation in type II fatty acid synthase systems. It is found in bacteria and plants. Elongation of fatty acids in the type II systems occurs by Claisen condensation of malonyl-acyl...; Region: KAS_III; cd00830
218497002124	dimer interface [polypeptide binding]; other site
218497002125	active site
218497002126	CoA binding pocket [chemical binding]; other site
218497002127	Pfam match to entry PF02797 Chal_stil_syntC, Chalcone and stilbene synthases, C-terminal domain , score 3.9, E-value 3.5e-05
218497002128	Acyl transferase domain; Region: Acyl_transf_1; cl08282
218497002129	malonyl CoA-acyl carrier protein transacylase; Region: fabD; TIGR00128
218497002130	Pfam match to entry PF00698 Acyl_transf, Acyl transferase domain , score 129.2, E-value 4.9e-36
218497002131	3-ketoacyl-(acyl-carrier-protein) reductase; Validated; Region: fabG; PRK05653
218497002132	beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs; Region: BKR_SDR_c; cd05333
218497002133	NAD(P) binding site [chemical binding]; other site
218497002134	homotetramer interface [polypeptide binding]; other site
218497002135	homodimer interface [polypeptide binding]; other site
218497002136	active site
218497002137	Pfam match to entry PF00106 adh_short, short chain dehydrogenase , score 331.5, E-value 6e-97
218497002138	PS00061 Short-chain dehydrogenases/reductases family signature.
218497002139	Phosphopantetheine attachment site; Region: PP-binding; cl09936
218497002140	Pfam match to entry PF00550 pp-binding, Phosphopantetheine attachment site , score 74.4, E-value 1.5e-19
218497002141	PS00012 Phosphopantetheine attachment site.
218497002142	effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO...; Region: CAP_ED; cd00038
218497002143	ligand binding site [chemical binding]; other site
218497002144	flexible hinge region; other site
218497002145	Pfam match to entry PF00027 cNMP_binding, Cyclic nucleotide-binding domain , score 68.2, E-value 1.2e-17
218497002146	TLC ATP/ADP transporter; Region: TLC; cl03940
218497002147	11 probable transmembrane helices predicted for CAB475 by TMHMM2.0 at aa 20-39, 54-76, 83-105, 115-137, 150-172, 176-198, 232-254, 274-293, 300-322, 363-385 and 390-412
218497002148	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002149	2 probable transmembrane helices predicted for CAB476 by TMHMM2.0 at aa 110-132 and 147-169
218497002150	2 probable transmembrane helices predicted for CAB477 by TMHMM2.0 at aa 127-149 and 164-186
218497002151	Sodium:neurotransmitter symporter family; Region: SNF; cl11976
218497002152	Pfam match to entry PF00209 SNF, Sodium:neurotransmitter symporter family , score -145.6, E-value 1.3e-14
218497002153	11 probable transmembrane helices predicted for CAB478 by TMHMM2.0 at aa 7-29, 44-66, 87-109, 135-157, 170-189, 249-271, 284-301, 316-338, 351-373, 378-400 and 424-446
218497002154	Signal peptide predicted for CAB478 by SignalP 2.0 HMM (Signal peptide probabilty 0.981) with cleavage site probability 0.764 between residues 24 and 25
218497002155	Sodium:dicarboxylate symporter family; Region: SDF; cl00573
218497002156	Pfam match to entry PF00375 SDF, Sodium:dicarboxylate symporter family , score 44.5, E-value 7.1e-13
218497002157	8 probable transmembrane helices predicted for CAB480 by TMHMM2.0 at aa 13-35, 41-63, 83-105, 146-165, 178-200, 215-237, 292-314 and 324-346
218497002158	Signal peptide predicted for CAB479 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.524 between residues 25 and 26
218497002159	5 probable transmembrane helices predicted for CAB481 by TMHMM2.0 at aa 57-79, 84-106, 182-204, 209-228 and 249-271
218497002160	Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism]; Region: MgtE; COG2239
218497002161	MgtE intracellular N domain; Region: MgtE_N; cl15244
218497002162	This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE.  MgtE and its homologs are found in eubacteria, archaebacteria, and eukaryota. Members of this family transport Mg2+ or other...; Region: CBS_pair_Mg_transporter; cd04606
218497002163	Divalent cation transporter; Region: MgtE; cl00786
218497002164	Pfam match to entry PF03448 MgtE_N, MgtE intracellular domain , score 182.8, E-value 3.7e-52
218497002165	Pfam match to entry PF00571 CBS, CBS domain , score 16.5, E-value 0.029
218497002166	Pfam match to entry PF00571 CBS, CBS domain , score 46.6, E-value 3.7e-11
218497002167	5 probable transmembrane helices predicted for CAB483 by TMHMM2.0 at aa 291-313, 320-342, 375-397, 409-431 and 451-469
218497002168	Pfam match to entry PF01769 MgtE, Divalent cation transporter , score 180.6, E-value 1.7e-51
218497002169	Signal peptide predicted for CAB484 by SignalP 2.0 HMM (Signal peptide probabilty 0.835) with cleavage site probability 0.394 between residues 25 and 26
218497002170	1 probable transmembrane helix predicted for CAB484 by TMHMM2.0 at aa 31-53
218497002171	Amino acid transporters [Amino acid transport and metabolism]; Region: PotE; COG0531
218497002172	Amino acid permease; Region: AA_permease; cl00524
218497002173	12 probable transmembrane helices predicted for CAB485 by TMHMM2.0 at aa 12-31, 41-63, 84-106, 121-143, 152-174, 189-211, 232-254, 278-300, 329-348, 358-380, 400-422 and 437-459
218497002174	Pfam match to entry PF00324 aa_permeases, Amino acid permease , score -177.9, E-value 1e-05
218497002175	DhnA-type fructose-1,6-bisphosphate aldolase and related enzymes [Carbohydrate transport and metabolism]; Region: FbaB; COG1830
218497002176	Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs); Region: DhnA; cd00958
218497002177	putative active site; other site
218497002178	catalytic residue [active]
218497002179	2 probable transmembrane helices predicted for CAB487 by TMHMM2.0 at aa 50-72 and 79-101
218497002180	ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]; Region: AbcC; COG1135
218497002181	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002182	Walker A/P-loop; other site
218497002183	ATP binding site [chemical binding]; other site
218497002184	Q-loop/lid; other site
218497002185	ABC transporter signature motif; other site
218497002186	Walker B; other site
218497002187	D-loop; other site
218497002188	H-loop/switch region; other site
218497002189	NIL domain; Region: NIL; cl09633
218497002190	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 182.9, E-value 3.4e-52
218497002191	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002192	PS00211 ABC transporters family signature.
218497002193	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cl00427
218497002194	5 probable transmembrane helices predicted for CAB489 by TMHMM2.0 at aa 20-42, 55-77, 87-109, 153-175 and 185-207
218497002195	Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component , score 18.4, E-value 0.00095
218497002196	Tripartite tricarboxylate transporter family receptor; Region: TctC; cl15260
218497002197	Signal peptide predicted for CAB490 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.285 between residues 22 and 23
218497002198	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002199	Pfam match to entry PF03180 Lipoprotein_9, NLPA lipoprotein , score 229.4, E-value 3.4e-66
218497002200	Signal peptide predicted for CAB491 by SignalP 2.0 HMM (Signal peptide probabilty 0.628) with cleavage site probability 0.505 between residues 26 and 27
218497002201	3 probable transmembrane helices predicted for CAB491 by TMHMM2.0 at aa 42-61, 100-122 and 126-148
218497002202	Protein of unknown function (DUF721); Region: DUF721; cl02324
218497002203	DNA gyrase subunit B; Provisional; Region: gyrB; PRK14939
218497002204	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
218497002205	ATP binding site [chemical binding]; other site
218497002206	Mg2+ binding site [ion binding]; other site
218497002207	G-X-G motif; other site
218497002208	TopoIIA_Trans_DNA_gyrase: Transducer domain, having a ribosomal S5 domain 2-like fold, of the type found in proteins of the type IIA family of DNA topoisomerases similar to the B subunits of E. coli DNA gyrase and E. coli Topoisomerase IV which are; Region: TopoII_Trans_DNA_gyrase; cd00822
218497002209	anchoring element; other site
218497002210	dimer interface [polypeptide binding]; other site
218497002211	ATP binding site [chemical binding]; other site
218497002212	TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM) nucleotidyl transferase/hydrolase domain of the type found in proteins of the type IIA family of DNA topoisomerases similar to the Escherichia coli GyrB subunit. TopoIIA enzymes cut both strands of the...; Region: TOPRIM_TopoIIA_GyrB; cd03366
218497002213	active site
218497002214	putative metal-binding site [ion binding]; other site
218497002215	DNA gyrase B subunit, carboxyl terminus; Region: DNA_gyraseB_C; pfam00986
218497002216	Pfam match to entry PF02518 HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase , score 106.5, E-value 3.3e-29
218497002217	Pfam match to entry PF00204 DNA_gyraseB, DNA gyrase B , score 311.6, E-value 5.9e-91
218497002218	PS00177 DNA topoisomerase II signature.
218497002219	Pfam match to entry PF01751 Toprim, Toprim domain , score 39.9, E-value 3.9e-09
218497002220	Pfam match to entry PF00986 DNA_gyraseB_C, DNA gyrase B subunit, carboxyl terminus , score 151.4, E-value 1e-42
218497002221	DNA gyrase, A subunit; Region: gyrA; TIGR01063
218497002222	DNA Topoisomerase, subtype IIA; domain A'; bacterial DNA topoisomerase IV (C subunit, ParC), bacterial DNA gyrases (A subunit, GyrA),mammalian DNA toposiomerases II. DNA topoisomerases are essential enzymes that regulate the conformational changes in DNA...; Region: TOP4c; cd00187
218497002223	CAP-like domain; other site
218497002224	active site
218497002225	primary dimer interface [polypeptide binding]; other site
218497002226	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
218497002227	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
218497002228	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
218497002229	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
218497002230	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
218497002231	DNA gyrase C-terminal domain, beta-propeller; Region: DNA_gyraseA_C; pfam03989
218497002232	Pfam match to entry PF00521 DNA_topoisoIV, DNA gyrase/topoisomerase IV, subunit A , score 980.0, E-value 3.8e-292
218497002233	Pfam match to entry PF03989 DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller , score 45.0, E-value 1.1e-10
218497002234	Pfam match to entry PF03989 DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller , score 49.3, E-value 5.6e-12
218497002235	Pfam match to entry PF03989 DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller , score 37.7, E-value 1.8e-08
218497002236	Pfam match to entry PF03989 DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller , score 62.0, E-value 8.1e-16
218497002237	Pfam match to entry PF03989 DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller , score 48.6, E-value 8.8e-12
218497002238	Pfam match to entry PF03989 DNA_gyraseA_C, DNA gyrase C-terminal domain, beta-propeller , score 54.0, E-value 2.2e-13
218497002239	thymidylate kinase; Validated; Region: tmk; PRK00698
218497002240	Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step...; Region: TMPK; cd01672
218497002241	TMP-binding site; other site
218497002242	ATP-binding site [chemical binding]; other site
218497002243	Pfam match to entry PF02223 Thymidylate_kin, Thymidylate kinase , score 236.6, E-value 2.4e-68
218497002244	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002245	PS01331 Thymidylate kinase signature.
218497002246	DNA polymerase III subunit delta'; Validated; Region: PRK05917
218497002247	Predicted helix-turn-helix motif with score 1067.000, SD 2.82 at aa 181-202, sequence MSITEVGKIVKGSVDTDKQVLR
218497002248	Phospholipase/Carboxylesterase; Region: Abhydrolase_2; pfam02230
218497002249	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cl12031
218497002250	Pfam match to entry PF02230 abhydrolase_2, Phospholipase/Carboxylesterase , score 257.2, E-value 1.4e-74
218497002251	yrdC domain; Region: Sua5_yciO_yrdC; cl00305
218497002252	Pfam match to entry PF01300 Sua5_yciO_yrdC, yrdC domain , score 87.5, E-value 1.8e-23
218497002253	PS01147 SUA5/yciO/yrdC family signature.
218497002254	Superfamily of metallo-dependent hydrolases (also called amidohydrolase superfamily) is a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site. The vast majority of the members have a...; Region: metallo-dependent_hydrolases; cl00281
218497002255	active site
218497002256	IncA protein; Region: IncA; pfam04156
218497002257	2 probable transmembrane helices predicted for CAB500 by TMHMM2.0 at aa 39-61 and 65-87
218497002258	HOOK protein; Region: HOOK; pfam05622
218497002259	4 probable transmembrane helices predicted for CAB501 by TMHMM2.0 at aa 37-59, 69-91, 147-169 and 174-196
218497002260	DNA recombination-mediator protein A; Region: DNA_processg_A; cl00695
218497002261	Pfam match to entry PF03641 Lysine_decarbox, Lysine decarboxylase , score 38.0, E-value 1.4e-08
218497002262	Signal peptide predicted for CAB502 by SignalP 2.0 HMM (Signal peptide probabilty 0.937) with cleavage site probability 0.374 between residues 23 and 24
218497002263	UbiA prenyltransferase family; Region: UbiA; cl00337
218497002264	Signal peptide predicted for CAB503 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.993 between residues 32 and 33
218497002265	Pfam match to entry PF01040 UbiA, UbiA prenyltransferase , score 150.6, E-value 1.8e-42
218497002266	8 probable transmembrane helices predicted for CAB503 by TMHMM2.0 at aa 49-71, 92-114, 119-136, 141-163, 173-195, 218-240, 245-267 and 279-298
218497002267	aromatic acid decarboxylase; Validated; Region: PRK05920
218497002268	Flavoprotein; Region: Flavoprotein; cl08021
218497002269	Signal peptide predicted for CAB504 by SignalP 2.0 HMM (Signal peptide probabilty 0.723) with cleavage site probability 0.698 between residues 17 and 18
218497002270	Pfam match to entry PF02441 Flavoprotein, Flavoprotein , score 158.1, E-value 1e-44
218497002271	Uncharacterized conserved protein [Function unknown]; Region: COG1284
218497002272	Uncharacterized BCR, YitT family COG1284; Region: DUF161; pfam02588
218497002273	Uncharacterized BCR, YitT family COG1284; Region: DUF161; pfam02588
218497002274	Uncharacterized protein conserved in bacteria (DUF2179); Region: DUF2179; cl10498
218497002275	6 probable transmembrane helices predicted for CAB505 by TMHMM2.0 at aa 47-66, 81-103, 110-132, 152-169, 190-212 and 217-239
218497002276	Pfam match to entry PF02588 DUF161, Uncharacterized BCR, YitT family COG1284 , score 74.0, E-value 2.1e-19
218497002277	Pfam match to entry PF02588 DUF161, Uncharacterized BCR, YitT family COG1284 , score 75.9, E-value 5.6e-20
218497002278	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002279	Survival protein SurE; Region: SurE; cl00448
218497002280	Pfam match to entry PF01975 SurE, Survival protein SurE , score 210.8, E-value 1.3e-60
218497002281	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002282	This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases superfamily  includes N type ATP PPases and ATP sulphurylases. It forms a apha/beta/apha fold which  binds to Adenosine group.  This subfamily; Region: Alpha_ANH_like_II; cd01993
218497002283	Ligand Binding Site [chemical binding]; other site
218497002284	Pfam match to entry PF01171 UPF0021, Uncharacterized protein family UPF0021 , score -68.4, E-value 4e-05
218497002285	Predicted metal-binding protein related to the C-terminal domain of SecA [General function prediction only]; Region: COG3318
218497002286	SEC-C motif; Region: SEC-C; pfam02810
218497002287	Pfam match to entry PF02810 SEC-C, SEC-C motif , score 41.3, E-value 1.4e-09
218497002288	PS00430 TonB-dependent receptor proteins signature 1.
218497002289	1 probable transmembrane helix predicted for CAB509 by TMHMM2.0 at aa 250-272
218497002290	ribosomal protein S12 methylthiotransferase RimO; Region: TIGR01125
218497002291	Uncharacterized protein family UPF0004; Region: UPF0004; pfam00919
218497002292	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497002293	FeS/SAM binding site; other site
218497002294	PS01278 Uncharacterized protein family UPF0004 signature.
218497002295	Pfam match to entry PF00919 UPF0004, Uncharacterized protein family UPF0004 , score 148.6, E-value 7.3e-42
218497002296	Ribosomal protein L33; Region: Ribosomal_L33; cl00383
218497002297	Pfam match to entry PF00471 Ribosomal_L33, Ribosomal protein L33 , score 54.9, E-value 1.2e-13
218497002298	PS00582 Ribosomal protein L33 signature.
218497002299	ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane]; Region: LolE; COG4591
218497002300	ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane]; Region: LolE; COG4591
218497002301	FtsX-like permease family; Region: FtsX; pfam02687
218497002302	4 probable transmembrane helices predicted for CAB514 by TMHMM2.0 at aa 21-43, 364-386, 407-429 and 464-486
218497002303	Pfam match to entry PF02687 DUF214, Predicted permease , score 107.1, E-value 2.2e-29
218497002304	ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]; Region: SalX; COG1136
218497002305	This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together...; Region: ABC_MJ0796_Lo1CDE_FtsE; cd03255
218497002306	Walker A/P-loop; other site
218497002307	ATP binding site [chemical binding]; other site
218497002308	Q-loop/lid; other site
218497002309	ABC transporter signature motif; other site
218497002310	Walker B; other site
218497002311	D-loop; other site
218497002312	H-loop/switch region; other site
218497002313	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 175.6, E-value 5.2e-50
218497002314	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002315	Predicted helix-turn-helix motif with score 981.000, SD 2.53 at aa 123-144, sequence KKALELIDSVGLSHRTHSRCCN
218497002316	PS00211 ABC transporters family signature.
218497002317	Similar to several Chlamydia proteins of undefined function including: Chlamydophila caviae hypothetical protein Cca00530 SWALL:Q822Z6 (EMBL:AE016995) (424 aa) fasta scores: E(): 1.2e-106, 58.29% id in 422 aa and Chlamydophila pneumoniae TW-183 hypothetical protein Cpb0363 SWALL:AAP98294 (EMBL:AE017158) (433 aa) fasta scores: E(): 4.9e-17, 24.25% id in 437 aa. Appears to have a frameshift mutation following codon 110 which occurs in a homopolymeric tract. This leaves open the possibility that the expression of its protein product may be subject to phase variation.;conserved membrane protein (pseudogene)
218497002318	homopolymeric tract in which the frameshift occurs
218497002319	2 probable transmembrane helices predicted for CAB517 by TMHMM2.0 at aa 32-54 and 58-80
218497002320	Ribosomal protein L13.  Protein L13, a large ribosomal subunit protein, is one of five proteins required for an early folding intermediate of 23S rRNA in the assembly of the large subunit. L13 is situated on the bottom of the large subunit, near the...; Region: Ribosomal_L13; cd00392
218497002321	23S rRNA interface [nucleotide binding]; other site
218497002322	L3 interface [polypeptide binding]; other site
218497002323	Pfam match to entry PF00572 Ribosomal_L13, Ribosomal protein L13 , score 187.4, E-value 1.5e-53
218497002324	PS00063 Aldo/keto reductase  active site signature.
218497002325	Ribosomal protein S9/S16; Region: Ribosomal_S9; cl00334
218497002326	Pfam match to entry PF00380 Ribosomal_S9, Ribosomal protein S9/S16 , score 142.7, E-value 4.1e-40
218497002327	PS00360 Ribosomal protein S9 signature.
218497002328	NlpC/P60 family; Region: NLPC_P60; cl11438
218497002329	Pfam match to entry PF00877 NLPC_P60, NLP/P60 family , score -1.9, E-value 0.00021
218497002330	Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for...; Region: ADK; cd01428
218497002331	adenylate kinase; Reviewed; Region: adk; PRK00279
218497002332	AMP-binding site [chemical binding]; other site
218497002333	ATP-AMP (Ap5A)-binding site [chemical binding]; other site
218497002334	Pfam match to entry PF00406 adenylatekinase, Adenylate kinase , score 232.8, E-value 3.2e-67
218497002335	2 probable transmembrane helices predicted for CAB522 by TMHMM2.0 at aa 195-217 and 227-249
218497002336	2 probable transmembrane helices predicted for CAB523 by TMHMM2.0 at aa 28-50 and 82-104
218497002337	3 probable transmembrane helices predicted for CAB524 by TMHMM2.0 at aa 117-139, 208-230 and 245-267
218497002338	6PGL: 6-Phosphogluconolactonase (6PGL) subfamily; 6PGL catalyzes the second step of the oxidative phase of the pentose phosphate pathway, the hydrolyzation of 6-phosphoglucono-1,5-lactone (delta form) to 6-phosphogluconate. 6PGL is thought to guard...; Region: 6PGL; cd01400
218497002339	putative active site [active]
218497002340	Pfam match to entry PF01182 Glucosamine_iso, Glucosamine-6-phosphate isomerases/6-phosphogluconolactonase , score -71.3, E-value 0.002
218497002341	glucose-6-phosphate 1-dehydrogenase; Validated; Region: PRK05722
218497002342	Glucose-6-phosphate dehydrogenase, NAD binding domain; Region: G6PD_N; pfam00479
218497002343	Glucose-6-phosphate dehydrogenase, C-terminal domain; Region: G6PD_C; pfam02781
218497002344	Pfam match to entry PF02781 G6PD_C, Glucose-6-phosphate dehydrogenase, C-terminal domain , score 449.6, E-value 1.7e-132
218497002345	Pfam match to entry PF00479 G6PD, Glucose-6-phosphate dehydrogenase, NAD binding domain , score 240.3, E-value 1.8e-69
218497002346	PS00069 Glucose-6-phosphate dehydrogenase active site.
218497002347	ABC-type oligopeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: OppA; COG4166
218497002348	The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; Region: PBP2_OppA; cd08504
218497002349	peptide binding site [polypeptide binding]; other site
218497002350	Pfam match to entry PF00496 SBP_bac_5, Bacterial extracellular solute-binding proteins, family 5 , score 199.3, E-value 3.9e-57
218497002351	Signal peptide predicted for CAB527 by SignalP 2.0 HMM (Signal peptide probabilty 0.961) with cleavage site probability 0.673 between residues 22 and 23
218497002352	UGMP family protein; Validated; Region: PRK09604
218497002353	Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones]; Region: COG1214; cl14000
218497002354	Pfam match to entry PF00814 Peptidase_M22, Glycoprotease , score 392.9, E-value 2.1e-115
218497002355	Similar to Escherichia coli, Escherichia coli O157:H7, and Shigella flexneri arginine repressor ArgR or XerA or b3237 or z4596 or ecs4110 or sf3277 or s3492 SWALL:ARGR_ECOLI (SWALL:P15282) (156 aa) fasta scores: E(): 3.2e-10, 39.04% id in 146 aa and to Haemophilus influenzae arginine repressor ArgR or hi1209 SWALL:ARGR_HAEIN (SWALL:P45110) (151 aa) fasta scores: E(): 9.3e-13, 39.72% id in 146 aa. Appears to have undergone a frameshift mutation following codon 57.;arginine repressor (pseudogene)
218497002356	Pfam match to entry PF02863 Arg_repressor_C, Arginine repressor, C-terminal domain , score 103.1, E-value 3.6e-28
218497002357	ABC-type arginine transport system, permease component [Amino acid transport and metabolism]; Region: ArtQ; COG4215
218497002358	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
218497002359	dimer interface [polypeptide binding]; other site
218497002360	conserved gate region; other site
218497002361	putative PBP binding loops; other site
218497002362	ABC-ATPase subunit interface; other site
218497002363	3 probable transmembrane helices predicted for CAB530 by TMHMM2.0 at aa 15-37, 58-80 and 187-209
218497002364	Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component , score 55.1, E-value 1e-13
218497002365	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
218497002366	7xpoly G tract
218497002367	ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]; Region: GlnQ; COG1126
218497002368	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002369	Walker A/P-loop; other site
218497002370	ATP binding site [chemical binding]; other site
218497002371	Q-loop/lid; other site
218497002372	ABC transporter signature motif; other site
218497002373	Walker B; other site
218497002374	D-loop; other site
218497002375	H-loop/switch region; other site
218497002376	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 177.4, E-value 1.5e-50
218497002377	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002378	PS00211 ABC transporters family signature.
218497002379	Signal peptide predicted for CAB533 by SignalP 2.0 HMM (Signal peptide probabilty 0.990) with cleavage site probability 0.515 between residues 31 and 32
218497002380	Ribonuclease BN-like family; Region: Ribonuclease_BN; cl07918
218497002381	Uncharacterized protein conserved in archaea (DUF2250); Region: DUF2250; pfam10007
218497002382	Pfam match to entry PF03631 Ribonuclease_BN, Ribonuclease BN-like family , score 15.7, E-value 2.3e-07
218497002383	6 probable transmembrane helices predicted for CAB534 by TMHMM2.0 at aa 46-65, 105-127, 148-170, 193-215, 228-250 and 265-287
218497002384	SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only]; Region: SmtA; COG0500
218497002385	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
218497002386	S-adenosylmethionine binding site [chemical binding]; other site
218497002387	IncA protein; Region: IncA; pfam04156
218497002388	2 probable transmembrane helices predicted for CAB536 by TMHMM2.0 at aa 71-93 and 98-117
218497002389	Ribulose-5-phosphate 3-epimerase (RPE). This enzyme catalyses the interconversion of D-ribulose 5-phosphate (Ru5P) into D-xylulose 5-phosphate, as part of the Calvin cycle (reductive pentose phosphate pathway) in chloroplasts and in the oxidative pentose...; Region: RPE; cd00429
218497002390	ribulose-phosphate 3-epimerase; Region: rpe; TIGR01163
218497002391	substrate binding site [chemical binding]; other site
218497002392	hexamer interface [polypeptide binding]; other site
218497002393	metal binding site [ion binding]; metal-binding site
218497002394	Signal peptide predicted for CAB537 by SignalP 2.0 HMM (Signal peptide probabilty 0.619) with cleavage site probability 0.346 between residues 24 and 25
218497002395	Pfam match to entry PF00834 Ribul_P_3_epim, Ribulose-phosphate 3 epimerase , score 279.7, E-value 2.5e-81
218497002396	PS01085 Ribulose-phosphate 3-epimerase signature 1.
218497002397	PS01086 Ribulose-phosphate 3-epimerase signature 2.
218497002398	elongation factor P; Provisional; Region: PRK12426
218497002399	Elongation factor P (EF-P) KOW-like domain; Region: EFP_N; pfam08207
218497002400	S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_1; cd04470
218497002401	RNA binding site [nucleotide binding]; other site
218497002402	S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_2; cd05794
218497002403	RNA binding site [nucleotide binding]; other site
218497002404	Pfam match to entry PF01132 EFP, Elongation factor P (EF-P) , score 105.7, E-value 5.8e-29
218497002405	PS01275 Elongation factor P signature.
218497002406	acetyl-CoA carboxylase biotin carboxyl carrier protein subunit; Validated; Region: PRK06302
218497002407	The biotinyl-domain or biotin carboxyl carrier protein (BCCP) domain is present in all biotin-dependent enzymes, such as acetyl-CoA carboxylase, pyruvate carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA carboxylase, geranyl-CoA carboxylase; Region: biotinyl_domain; cd06850
218497002408	carboxyltransferase (CT) interaction site; other site
218497002409	biotinylation site [posttranslational modification]; other site
218497002410	Pfam match to entry PF00364 biotin_lipoyl, Biotin-requiring enzyme , score 102.8, E-value 4.4e-28
218497002411	acetyl-CoA carboxylase biotin carboxylase subunit; Validated; Region: PRK08591
218497002412	Carbamoyl-phosphate synthase L chain, N-terminal domain; Region: CPSase_L_chain; pfam00289
218497002413	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; cl03087
218497002414	Biotin carboxylase C-terminal domain; Region: Biotin_carb_C; cl08365
218497002415	Pfam match to entry PF00289 CPSase_L_chain, Carbamoyl-phosphate synthase L chain, N-terminal domain , score 159.7, E-value 3.3e-45
218497002416	Pfam match to entry PF02786 CPSase_L_D2, Carbamoyl-phosphate synthase L chain, ATP binding domain , score 341.2, E-value 7.7e-100
218497002417	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
218497002418	Pfam match to entry PF02785 Biotin_carb_C, Biotin carboxylase C-terminal domain , score 222.3, E-value 4.7e-64
218497002419	Pseudogene. Similar to Chlamydophila caviae hypothetical protein CCA00555 SWALL:Q822X3 (EMBL:AE016996) (484 aa) fasta scores: E(): 5.1e-109, 57.75% id in 490 aa. This CDS has multiple frameshift mutations;conserved membrane protein (pseudogene)
218497002420	1 probable transmembrane helix predicted for CAB541 by TMHMM2.0 at aa 43-65
218497002421	Pseudogene. Similar to Chlamydophila caviae hypothetical protein cca00556 SWALL:Q822X2 (EMBL:AE016996) (548 aa) fasta scores: E(): 1.9e-123, 58.79% id in 546 aa. The frameshift in this CDS occurs within a homopolymeric tract leaving open the possibility that the expression of the protein product of this CDS is subject to phase variation;conserved inner membrane protein (pseudogene)
218497002422	homopolmeric tract in which the frameshift occurs
218497002423	2 probable transmembrane helices predicted for CAB545 by TMHMM2.0 at aa 31-53 and 58-80
218497002424	Family of unknown function (DUF648); Region: DUF648; pfam04890
218497002425	1 probable transmembrane helix predicted for CAB547 by TMHMM2.0 at aa 63-85
218497002426	Protein of unknown function (DUF1389); Region: DUF1389; pfam07146
218497002427	1 probable transmembrane helix predicted for CAB549 by TMHMM2.0 at aa 75-97
218497002428	Pseudogene. Similar to Aquifex aeolicus inosine-5'-monophosphate dehydrogenase GuaB or AQ_2023 SWALL:IMDH_AQUAE (SWALL:O67820) (490 aa) fasta scores: E(): 1.6e-48, 40.48% id in 457 aa, and to Escherichia coli, Escherichia coli O157:H7, and Shigella flexneri inosine-5'-monophosphate dehydrogenase GuaB or GuaR or B2508 or Z3772 or ECS3370 or SF2554 or S2726 SWALL:IMDH_ECOLI (SWALL:P06981) (488 aa) fasta scores: E(): 8.4e-46, 39.56% id in 455 aa. This CDS carries a frameshift mutation and a premature stop codon within its sequence and appears to be missing the very C-terminal region.;inosine-5'-monophosphate dehydrogenase (pseudogene)
218497002429	Pfam match to entry PF00478 IMPDH, IMP dehydrogenase / GMP reductase , score 78.4, E-value 9.8e-21
218497002430	PS00487 IMP dehydrogenase / GMP reductase signature.
218497002431	Pfam match to entry PF00478 IMPDH, IMP dehydrogenase / GMP reductase , score 149.6, E-value 1.4e-42
218497002432	GGCT-like domains, also called AIG2-like family. Gamma-glutamyl cyclotransferase (GGCT) catalyzes the formation of pyroglutamic acid (5-oxoproline) from dipeptides containing gamma-glutamyl, and is a dimeric protein. In Homo sapiens, the protein is...; Region: GGCT_like; cd06661
218497002433	putative active site pocket [active]
218497002434	dimerization interface [polypeptide binding]; other site
218497002435	putative catalytic residue [active]
218497002436	Signal peptide predicted for CAB553 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.678 between residues 25 and 26
218497002437	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002438	2 probable transmembrane helices predicted for CAB554 by TMHMM2.0 at aa 43-65 and 72-94
218497002439	Pseudogene. Similar to Chlamydophila caviae hypothetical protein CCA00578 SWALL:Q822V1 (EMBL:AE016996) (280 aa) fasta scores: E(): 1.2e-66, 66.01% id in 256 aa, and to Chlamydia pneumoniae hypothetical protein CPN0177 or CPJ0177 or CP0592 SWALL:Q9Z907 (EMBL:AE001604) (284 aa) fasta scores: E(): 2.7e-07, 25.44% id in 224 aa. This CDS carries a premature stop codon and a C-terminal sequence deletion.;conserved hypothetical lipoprotein (pseudogene)
218497002440	Signal peptide predicted for CAB555 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.470 between residues 28 and 29
218497002441	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002442	2 probable transmembrane helices predicted for CAB557 by TMHMM2.0 at aa 90-112 and 117-139
218497002443	Uncharacterized ACR, YhhQ family COG1738; Region: DUF165; cl00756
218497002444	Pfam match to entry PF02592 DUF165, Uncharacterized ACR, YhhQ family COG1738 , score 208.9, E-value 5e-60
218497002445	6 probable transmembrane helices predicted for CAB558 by TMHMM2.0 at aa 12-34, 49-71, 84-103, 118-140, 165-187 and 192-214
218497002446	Queuine tRNA-ribosyltransferase; Region: TGT; cl00409
218497002447	Pfam match to entry PF01702 TGT, Queuine tRNA-ribosyltransferase , score 178.1, E-value 9.1e-51
218497002448	3 probable transmembrane helices predicted for CAB560 by TMHMM2.0 at aa 56-78, 88-110 and 117-136
218497002449	Similar to Chlamydophila caviae hypothetical protein cca00584 SWALL:Q822U5 (EMBL:AE016996) (275 aa) fasta scores: E(): 5e-14, 46.35% id in 274 aa. Note the premature in-frame stop codon following codon 9; inner membrane protein (pseudogene)
218497002450	1 probable transmembrane helix predicted for CAB561 by TMHMM2.0 at aa 28-50
218497002451	Disulfide bond formation protein DsbB; Region: DsbB; cl00649
218497002452	Pfam match to entry PF02600 DsbB, Disulfide bond formation protein DsbB , score 173.9, E-value 1.7e-49
218497002453	4 probable transmembrane helices predicted for CAB562 by TMHMM2.0 at aa 7-29, 39-56, 63-85 and 105-127
218497002454	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002455	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
218497002456	Signal peptide predicted for CAB563 by SignalP 2.0 HMM (Signal peptide probabilty 0.771) with cleavage site probability 0.624 between residues 24 and 25
218497002457	Signal peptide predicted for CAB564 by SignalP 2.0 HMM (Signal peptide probabilty 0.747) with cleavage site probability 0.741 between residues 63 and 64
218497002458	9 probable transmembrane helices predicted for CAB564 by TMHMM2.0 at aa 92-109, 116-138, 194-213, 226-245, 250-272, 327-344, 359-376, 383-405 and 409-426
218497002459	2 probable transmembrane helices predicted for CAB565 by TMHMM2.0 at aa 44-66 and 81-103
218497002460	ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]; Region: TauB; COG1116
218497002461	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002462	Walker A/P-loop; other site
218497002463	ATP binding site [chemical binding]; other site
218497002464	Q-loop/lid; other site
218497002465	ABC transporter signature motif; other site
218497002466	Walker B; other site
218497002467	D-loop; other site
218497002468	H-loop/switch region; other site
218497002469	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 176.2, E-value 3.5e-50
218497002470	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002471	Pseudogene. Similar to Chlamydophila caviae 5'-methylthioadenosine nucleosidase-related protein CCA00593 SWALL:Q822T6 (EMBL:AE016996) (297 aa) fasta scores: E(): 7e-100, 82.49% id in 297 aa, and to Ralstonia solanacearum probable bifunctional protein Pfs or RSC3374 or RS02649 SWALL:Q8XU20 (EMBL:AL646075) (261 aa) fasta scores: E(): 6.6e-08, 23.73% id in 257 aa. Note this CDS carries multiple frameshift mutations.;conserved hypothetical protein (pseudogene)
218497002472	Signal peptide predicted for CAB568 by SignalP 2.0 HMM (Signal peptide probabilty 0.986) with cleavage site probability 0.959 between residues 55 and 56
218497002473	CMP-KDO synthetase catalyzes the activation of KDO which is an essential component of the lipopolysaccharide; Region: CMP-KDO-Synthetase; cd02517
218497002474	Ligand binding site; other site
218497002475	oligomer interface; other site
218497002476	Pfam match to entry PF02348 CTP_transf_3, Cytidylyltransferase , score 301.0, E-value 9.5e-88
218497002477	CTP synthetase; Validated; Region: pyrG; PRK05380
218497002478	CTP synthetase (CTPs) is a two-domain protein, which consists of an N-terminal synthetase domain and C-terminal glutaminase domain. The enzymes hydrolyze the amide bond of glutamine to ammonia and glutamate at the glutaminase domains and transfer nascent...; Region: CTGs; cd03113
218497002479	Catalytic site [active]
218497002480	active site
218497002481	UTP binding site [chemical binding]; other site
218497002482	Type 1 glutamine amidotransferase (GATase1) domain found in Cytidine Triphosphate Synthetase; Region: GATase1_CTP_Synthase; cd01746
218497002483	active site
218497002484	putative oxyanion hole; other site
218497002485	catalytic triad [active]
218497002486	Signal peptide predicted for CAB570 by SignalP 2.0 HMM (Signal peptide probabilty 0.880) with cleavage site probability 0.423 between residues 22 and 23
218497002487	Pfam match to entry PF00117 GATase, Glutamine amidotransferase class-I , score 221.7, E-value 6.9e-64
218497002488	PS00442 Glutamine amidotransferases class-I active site.
218497002489	Holliday junction resolvases (HJRs) are endonucleases that specifically resolve Holliday junction DNA intermediates during homologous recombination.  HJR's occur in archaea, bacteria, and in the mitochondria of certain fungi, however this CD includes...; Region: RuvC_resolvase; cl00243
218497002490	Pfam match to entry PF03652 UPF0081, Uncharacterised protein family (UPF0081) , score 177.5, E-value 1.4e-50
218497002491	1 probable transmembrane helix predicted for CAB571 by TMHMM2.0 at aa 20-39
218497002492	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002493	The substrate-binding domain of an ABC-type nickel/oligopeptide-like import system contains the type 2 periplasmic binding fold; Region: PBP2_NikA_DppA_OppA_like; cl01709
218497002494	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
218497002495	Signal peptide predicted for CAB572 by SignalP 2.0 HMM (Signal peptide probabilty 0.966) with cleavage site probability 0.446 between residues 35 and 36
218497002496	Pfam match to entry PF00496 SBP_bac_5, Bacterial extracellular solute-binding proteins, family 5 , score 28.2, E-value 4e-16
218497002497	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002498	ABC-type oligopeptide transport system, periplasmic component [Amino acid transport and metabolism]; Region: OppA; COG4166
218497002499	The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; Region: PBP2_OppA; cd08504
218497002500	peptide binding site [polypeptide binding]; other site
218497002501	Pfam match to entry PF00496 SBP_bac_5, Bacterial extracellular solute-binding proteins, family 5 , score 223.3, E-value 2.4e-64
218497002502	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497002503	The substrate-binding component of an ABC-type oligopetide import system contains the type 2 periplasmic binding fold; Region: PBP2_OppA; cd08504
218497002504	peptide binding site [polypeptide binding]; other site
218497002505	Bacterial extracellular solute-binding proteins, family 5 Middle; Region: SBP_bac_5; pfam00496
218497002506	Signal peptide predicted for CAB574 by SignalP 2.0 HMM (Signal peptide probabilty 0.909) with cleavage site probability 0.720 between residues 26 and 27
218497002507	Pfam match to entry PF00496 SBP_bac_5, Bacterial extracellular solute-binding proteins, family 5 , score 181.7, E-value 7.5e-52
218497002508	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppB; COG0601
218497002509	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
218497002510	dimer interface [polypeptide binding]; other site
218497002511	conserved gate region; other site
218497002512	putative PBP binding loops; other site
218497002513	ABC-ATPase subunit interface; other site
218497002514	Signal peptide predicted for CAB575 by SignalP 2.0 HMM (Signal peptide probabilty 0.935) with cleavage site probability 0.577 between residues 28 and 29
218497002515	6 probable transmembrane helices predicted for CAB575 by TMHMM2.0 at aa 89-111, 132-154, 174-196, 216-238, 242-264 and 277-299
218497002516	Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component , score 19.4, E-value 0.00075
218497002517	ABC-type dipeptide/oligopeptide/nickel transport systems, permease components [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppC; COG1173
218497002518	N-terminal TM domain of oligopeptide transport permease C; Region: OppC_N; pfam12911
218497002519	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
218497002520	dimer interface [polypeptide binding]; other site
218497002521	conserved gate region; other site
218497002522	putative PBP binding loops; other site
218497002523	ABC-ATPase subunit interface; other site
218497002524	6 probable transmembrane helices predicted for CAB576 by TMHMM2.0 at aa 25-47, 85-107, 122-144, 151-173, 209-231 and 252-274
218497002525	Pfam match to entry PF00528 BPD_transp, Binding-protein-dependent transport systems inner membrane component , score 50.0, E-value 3.3e-12
218497002526	The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane...; Region: ABC_NikE_OppD_transporters; cd03257
218497002527	nickel import ATP-binding protein NikD; Region: nickel_nikD; TIGR02770
218497002528	Walker A/P-loop; other site
218497002529	ATP binding site [chemical binding]; other site
218497002530	Q-loop/lid; other site
218497002531	ABC transporter signature motif; other site
218497002532	Walker B; other site
218497002533	D-loop; other site
218497002534	H-loop/switch region; other site
218497002535	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
218497002536	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 165.1, E-value 7.9e-47
218497002537	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002538	ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]; Region: DppF; COG1124
218497002539	The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane...; Region: ABC_NikE_OppD_transporters; cd03257
218497002540	Walker A/P-loop; other site
218497002541	ATP binding site [chemical binding]; other site
218497002542	Q-loop/lid; other site
218497002543	ABC transporter signature motif; other site
218497002544	Walker B; other site
218497002545	D-loop; other site
218497002546	H-loop/switch region; other site
218497002547	Oligopeptide/dipeptide transporter, C-terminal region; Region: oligo_HPY; cl07097
218497002548	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 206.1, E-value 3.5e-59
218497002549	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002550	PS00211 ABC transporters family signature.
218497002551	Protein of unknown function (DUF1186); Region: DUF1186; pfam06685
218497002552	Di- and tricarboxylate transporters [Inorganic ion transport and metabolism]; Region: CitT; COG0471
218497002553	Anion permease ArsB/NhaD.  These permeases have been shown to translocate sodium, arsenate, antimonite, sulfate and organic anions across biological membranes in all three kingdoms of life.  A typical anion permease contains 8-13 transmembrane helices...; Region: ArsB_NhaD_permease; cd00625
218497002554	transmembrane helices; other site
218497002555	Signal peptide predicted for CAB580 by SignalP 2.0 HMM (Signal peptide probabilty 0.961) with cleavage site probability 0.684 between residues 28 and 29
218497002556	Pfam match to entry PF00939 Na_sulph_symp, Sodium:sulfate symporter transmembrane region , score 869.7, E-value 5.9e-259
218497002557	9 probable transmembrane helices predicted for CAB580 by TMHMM2.0 at aa 44-66, 182-204, 214-236, 266-284, 289-311, 324-346, 361-378, 390-412 and 442-464
218497002558	Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to PFK family that includes ATP- and pyrophosphate (PPi)- dependent phosphofructokinases; Region: PFK; cl00204
218497002559	active site
218497002560	ADP/pyrophosphate binding site [chemical binding]; other site
218497002561	dimerization interface [polypeptide binding]; other site
218497002562	allosteric effector site; other site
218497002563	fructose-1,6-bisphosphate binding site; other site
218497002564	Pfam match to entry PF00365 PFK, Phosphofructokinase , score -54.1, E-value 5.3e-10
218497002565	Hydrolases of the alpha/beta superfamily [General function prediction only]; Region: COG1073
218497002566	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cl12031
218497002567	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cl12031
218497002568	1 probable transmembrane helix predicted for CAB582 by TMHMM2.0 at aa 13-35
218497002569	Phosphofructokinase, a key regulatory enzyme in glycolysis, catalyzes the phosphorylation of fructose-6-phosphate to fructose-1,6-biphosphate. The members belong to PFK family that includes ATP- and pyrophosphate (PPi)- dependent phosphofructokinases; Region: PFK; cl00204
218497002570	active site
218497002571	ADP/pyrophosphate binding site [chemical binding]; other site
218497002572	dimerization interface [polypeptide binding]; other site
218497002573	allosteric effector site; other site
218497002574	fructose-1,6-bisphosphate binding site; other site
218497002575	Pfam match to entry PF00365 PFK, Phosphofructokinase , score -69.0, E-value 4.8e-09
218497002576	3-deoxy-D-manno-octulosonic-acid transferase; Reviewed; Region: PRK05749
218497002577	3-Deoxy-D-manno-octulosonic-acid transferase (kdotransferase); Region: Glycos_transf_N; pfam04413
218497002578	leucyl-tRNA synthetase; Validated; Region: leuS; PRK00390
218497002579	catalytic core domain of leucyl-tRNA synthetases; Region: LeuRS_core; cd00812
218497002580	HIGH motif; other site
218497002581	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
218497002582	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
218497002583	active site
218497002584	KMSKS motif; other site
218497002585	Anticodon-binding domain of bacterial and eukaryotic mitochondrial leucyl tRNA synthetases; Region: Anticodon_Ia_Leu_BEm; cd07958
218497002586	tRNA binding surface [nucleotide binding]; other site
218497002587	Pfam match to entry PF00133 tRNA-synt_1, tRNA synthetases class I (I, L, M and V) , score 419.8, E-value 1.6e-123
218497002588	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
218497002589	Hydrolases of the alpha/beta superfamily [General function prediction only]; Region: COG1073
218497002590	Esterases and lipases (includes fungal lipases, cholinesterases, etc.)  These enzymes act on carboxylic esters (EC: 3.1.1.-). The catalytic apparatus involves three residues (catalytic triad): a serine, a glutamate or aspartate and a histidine.These...; Region: Esterase_lipase; cl12031
218497002591	Signal peptide predicted for CAB586 by SignalP 2.0 HMM (Signal peptide probability 0.999) with cleavage site probability 0.932 between residues 20 and 21
218497002592	2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion]; Region: UbiH; COG0654
218497002593	3 probable transmembrane helices predicted for CAB588 by TMHMM2.0 at aa 73-95, 99-118 and 830-852
218497002594	NAD-dependent DNA ligase LigA; Validated; Region: ligA; PRK07956
218497002595	NAD+ dependent DNA ligase adenylation domain. DNA ligases catalyze the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor, but using the same basic reaction...; Region: LIGANc; cd00114
218497002596	nucleotide binding pocket [chemical binding]; other site
218497002597	K-X-D-G motif; other site
218497002598	catalytic site [active]
218497002599	NAD-dependent DNA ligase OB-fold domain; Region: DNA_ligase_OB; pfam03120
218497002600	NAD-dependent DNA ligase C4 zinc finger domain; Region: DNA_ligase_ZBD; pfam03119
218497002601	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cl14786
218497002602	Breast Cancer Suppressor Protein (BRCA1), carboxy-terminal domain. The BRCT domain is found within many DNA damage repair and cell cycle checkpoint proteins. The unique diversity of this domain superfamily allows BRCT modules to interact forming homo...; Region: BRCT; cd00027
218497002603	Dimer interface [polypeptide binding]; other site
218497002604	BRCT sequence motif; other site
218497002605	Pfam match to entry PF00533 BRCT, BRCA1 C Terminus (BRCT) domain , score 50.9, E-value 1.8e-12
218497002606	Pfam match to entry PF00633 HHH, Helix-hairpin-helix motif , score 33.4, E-value 3.4e-07
218497002607	Pfam match to entry PF03119 DNA_ligase_ZBD, NAD-dependent DNA ligase C4 zinc finger domain , score 42.0, E-value 8.9e-10
218497002608	Pfam match to entry PF03120 DNA_ligase_OB, NAD-dependent DNA ligase OB-fold domain , score 181.9, E-value 6.6e-52
218497002609	PS01056 NAD-dependent DNA ligase signature 2.
218497002610	Pfam match to entry PF01653 DNA_ligase_N, NAD-dependent DNA ligase adenylation domain , score 371.9, E-value 4.3e-109
218497002611	Catalytic domain of Protein Kinases; Region: PKc; cd00180
218497002612	active site
218497002613	ATP binding site [chemical binding]; other site
218497002614	substrate binding site [chemical binding]; other site
218497002615	activation loop (A-loop); other site
218497002616	Formylglycine-generating sulfatase enzyme; Region: FGE-sulfatase; cl15394
218497002617	Pfam match to entry PF03781 DUF323, Domain of unknown function (DUF323) , score 310.8, E-value 1e-90
218497002618	Pfam match to entry PF00069 pkinase, Protein kinase domain , score 13.3, E-value 0.00087
218497002619	IncA protein; Region: IncA; pfam04156
218497002620	2 probable transmembrane helices predicted for CAB591 by TMHMM2.0 at aa 49-71 and 81-103
218497002621	2 probable transmembrane helices predicted for CAB593 by TMHMM2.0 at aa 40-62 and 67-89
218497002622	Uncharacterized conserved protein [Function unknown]; Region: COG2912
218497002623	putative PEP-CTERM system TPR-repeat lipoprotein; Region: PEP_TPR_lipo; TIGR02917
218497002624	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497002625	TPR motif; other site
218497002626	binding surface
218497002627	Similar to Chlamydia pneumoniae probable outer membrane protein pmp10 precursor or omp5 or cp0303 SWALL:PM10_CHLPN (SWALL:Q9RB65) (928 aa) fasta scores: E(): 8.4e-111, 41.5% id in 959 aa, and to Chlamydophila abortus pomp91b precursor SWALL:P71133 (EMBL:U65943) (846 aa) fasta scores: E(): 0, 97.75% id in 846 aa. Note the frameshift mutation within this CDS occurs in a homopolymeric tract,consequently the expression of its outer-membrane protein product is thought to be phase variable;polymorphic outer membrane protein (pseudogene)
218497002628	Signal peptide predicted for CAB596 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.983 between residues 23 and 24
218497002629	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 689.1, E-value 1.4e-204
218497002630	16 x poly G tract and the site of the frameshift. This is a candidate site for phase variation of the expression of this gene
218497002631	adhesin; Provisional; Region: PRK09752
218497002632	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497002633	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497002634	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497002635	Signal peptide predicted for CAB598 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.956 between residues 23 and 24
218497002636	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 692.5, E-value 1.3e-205
218497002637	15 x poly G tract. Possible site for phase variation
218497002638	ATP-dependent chaperone ClpB; Region: chaperone_ClpB; TIGR03346
218497002639	Clp amino terminal domain; Region: Clp_N; pfam02861
218497002640	Clp amino terminal domain; Region: Clp_N; pfam02861
218497002641	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497002642	Walker A motif; other site
218497002643	ATP binding site [chemical binding]; other site
218497002644	Walker B motif; other site
218497002645	arginine finger; other site
218497002646	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497002647	Walker A motif; other site
218497002648	ATP binding site [chemical binding]; other site
218497002649	Walker B motif; other site
218497002650	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; cl11083
218497002651	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002652	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 36.4, E-value 4.1e-08
218497002653	PS00870 Chaperonins clpA/B signature 1.
218497002654	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002655	Pfam match to entry PF02861 Clp_N, Clp amino terminal domain , score 49.3, E-value 5.5e-12
218497002656	Pfam match to entry PF02861 Clp_N, Clp amino terminal domain , score 28.8, E-value 8.2e-06
218497002657	mce related protein; Region: MCE; cl15431
218497002658	Signal peptide predicted for CAB600 by SignalP 2.0 HMM (Signal peptide probabilty 0.840) with cleavage site probability 0.575 between residues 34 and 35
218497002659	1 probable transmembrane helix predicted for CAB600 by TMHMM2.0 at aa 7-29
218497002660	ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]; Region: Ttg2A; COG1127
218497002661	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002662	Walker A/P-loop; other site
218497002663	ATP binding site [chemical binding]; other site
218497002664	Q-loop/lid; other site
218497002665	ABC transporter signature motif; other site
218497002666	Walker B; other site
218497002667	D-loop; other site
218497002668	H-loop/switch region; other site
218497002669	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 163.0, E-value 3.3e-46
218497002670	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002671	Domain of unknown function DUF140; Region: DUF140; cl00510
218497002672	7 probable transmembrane helices predicted for CAB602 by TMHMM2.0 at aa 9-31, 51-73, 86-108, 128-150, 157-179, 194-216 and 237-259
218497002673	Pfam match to entry PF02405 DUF140, Domain of unknown function DUF140 , score 158.5, E-value 7.4e-45
218497002674	glutamate-1-semialdehyde aminotransferase; Provisional; Region: PRK00615
218497002675	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
218497002676	inhibitor-cofactor binding pocket; inhibition site
218497002677	pyridoxal 5'-phosphate binding site [chemical binding]; other site
218497002678	catalytic residue [active]
218497002679	Pfam match to entry PF00202 aminotran_3, Aminotransferase class-III , score 114.1, E-value 1.7e-31
218497002680	Uncharacterized ACR, COG1678; Region: DUF179; cl00731
218497002681	Pfam match to entry PF02622 DUF179, Uncharacterized ACR, COG1678 , score 346.0, E-value 2.8e-101
218497002682	Uncharacterised ACR, COG1259; Region: DUF151; cl00553
218497002683	Pfam match to entry PF02577 DUF151, Uncharacterized ACR, COG1259 , score 250.6, E-value 1.4e-72
218497002684	RPI_A: Ribose 5-phosphate isomerase type A (RPI_A) subfamily; RPI catalyzes the reversible conversion of ribose-5-phosphate to ribulose 5-phosphate, the first step of the non-oxidative branch of the pentose phosphate pathway. This reaction leads to the...; Region: RPI_A; cd01398
218497002685	tetramer (dimer of dimers) interface [polypeptide binding]; other site
218497002686	active site
218497002687	dimer interface [polypeptide binding]; other site
218497002688	Pfam match to entry PF00455 deoR, Bacterial regulatory proteins, deoR family , score 16.9, E-value 8.6e-05
218497002689	Similar to Chlamydophila caviae hypothetical protein cca00634 SWALL:Q822P5 (EMBL:AE016996) (416 aa) fasta scores: E(): 1.2e-89, 53.88% id in 399 aa, and to Chlamydophila caviae hypothetical protein cca00636 SWALL:Q822P3 (EMBL:AE016996) (411 aa) fasta scores: E(): 2.3e-53, 38.1% id in 391 aa, and to Chlamydophila caviae hypothetical protein cca00639 SWALL:Q822P0 (EMBL:AE016996) (556 aa) fasta scores: E(): 3.9e-35, 35.33% id in 300 aa. This CDS carries a premature stop codon following residue 107.;conserved transmembrane protein (pseudogene)
218497002690	2 probable transmembrane helices predicted for CAB609 by TMHMM2.0 at aa 32-54 and 64-83
218497002691	Protein of unknown function (DUF1389); Region: DUF1389; pfam07146
218497002692	2 probable transmembrane helices predicted for CAB610 by TMHMM2.0 at aa 37-59 and 66-85
218497002693	Protein of unknown function (DUF1389); Region: DUF1389; pfam07146
218497002694	Uncharacterized conserved protein [Function unknown]; Region: COG0327
218497002695	NIF3 (NGG1p interacting factor 3); Region: NIF3; cl15371
218497002696	Pfam match to entry PF01784 DUF34, Domain of unknown function DUF34 , score 270.0, E-value 2e-78
218497002697	oligoendopeptidase F; Region: pepF; TIGR00181
218497002698	Peptidase family M3B Oligopeptidase F (PepF); Region: M3B_PepF_3; cd09608
218497002699	active site
218497002700	Zn binding site [ion binding]; other site
218497002701	Pfam match to entry PF01432 Peptidase_M3, Peptidase M3 , score 482.7, E-value 1.9e-142
218497002702	Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts. It...; Region: cpn10; cd00320
218497002703	oligomerisation interface [polypeptide binding]; other site
218497002704	mobile loop; other site
218497002705	roof hairpin; other site
218497002706	Pfam match to entry PF00166 cpn10, Chaperonin 10 Kd subunit , score 186.1, E-value 3.7e-53
218497002707	PS00681 Chaperonins cpn10 signature.
218497002708	chaperonin GroEL; Reviewed; Region: groEL; PRK12849
218497002709	GroEL_like type I chaperonin. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found...; Region: GroEL; cd03344
218497002710	ring oligomerisation interface [polypeptide binding]; other site
218497002711	ATP/Mg binding site [chemical binding]; other site
218497002712	stacking interactions; other site
218497002713	hinge regions; other site
218497002714	Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family , score 643.7, E-value 6.7e-191
218497002715	PS00296 Chaperonins cpn60 signature.
218497002716	1 probable transmembrane helix predicted for CAB616 by TMHMM2.0 at aa 16-33
218497002717	2 probable transmembrane helices predicted for CAB617 by TMHMM2.0 at aa 31-53 and 58-80
218497002718	Uncharacterized conserved protein [Function unknown]; Region: COG4285
218497002719	Type 1 glutamine amidotransferase (GATase1)-like domain found in proteins similar to Saccharomyces cerevisiae biotin-apoprotein ligase (ScBLP); Region: GATase1_ScBLP_like; cd03144
218497002720	conserved cys residue [active]
218497002721	EamA-like transporter family; Region: EamA; cl01037
218497002722	10 probable transmembrane helices predicted for CAB620 by TMHMM2.0 at aa 13-32, 47-64, 77-99, 103-125, 130-152, 162-184, 205-227, 242-264, 271-293 and 303-321
218497002723	Pfam match to entry PF00892 DUF6, Integral membrane protein DUF6 , score 22.2, E-value 0.00082
218497002724	helicase, putative, RecD/TraA family; Region: recD_rel; TIGR01448
218497002725	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497002726	Walker A motif; other site
218497002727	ATP binding site [chemical binding]; other site
218497002728	Walker B motif; other site
218497002729	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002730	methionyl-tRNA synthetase; Reviewed; Region: PRK12268
218497002731	catalytic core domain of methioninyl-tRNA synthetases; Region: MetRS_core; cd00814
218497002732	active site
218497002733	HIGH motif; other site
218497002734	KMSKS motif; other site
218497002735	Anticodon-binding domain of methionyl tRNA synthetases; Region: Anticodon_Ia_Met; cd07957
218497002736	tRNA binding surface [nucleotide binding]; other site
218497002737	anticodon binding site; other site
218497002738	Pfam match to entry PF00133 tRNA-synt_1, tRNA synthetases class I (I, L, M and V) , score -100.4, E-value 5.8e-14
218497002739	Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine...; Region: GMPK; cd00071
218497002740	catalytic site [active]
218497002741	G-X2-G-X-G-K; other site
218497002742	Pfam match to entry PF00625 Guanylate_kin, Guanylate kinase , score 108.8, E-value 6.7e-30
218497002743	PS00856 Guanylate kinase signature.
218497002744	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002745	bacterial Ribonuclease HII-like; Region: RNase_HII_bacteria_HII_like; cd07182
218497002746	RNA/DNA hybrid binding site [nucleotide binding]; other site
218497002747	active site
218497002748	Pfam match to entry PF01351 RNase_HII, Ribonuclease HII , score 223.2, E-value 2.4e-64
218497002749	Ribosomal protein L19; Region: Ribosomal_L19; cl00406
218497002750	Pfam match to entry PF01245 Ribosomal_L19, Ribosomal protein L19 , score 148.6, E-value 7.2e-42
218497002751	tRNA (guanine-N(1)-)-methyltransferase/unknown domain fusion protein; Reviewed; Region: trmD; PRK01037
218497002752	tRNA (Guanine-1)-methyltransferase; Region: tRNA_m1G_MT; cl00407
218497002753	This domain superfamily is found in a variety of structurally related metalloproteins, including the type I extradiol dioxygenases, glyoxalase I and a group of antibiotic resistance proteins; Region: Glo_EDI_BRP_like; cl14632
218497002754	active site
218497002755	metal binding site [ion binding]; metal-binding site
218497002756	Pfam match to entry PF01746 tRNA_m1G_MT, tRNA (Guanine-1)-methyltransferase , score 316.3, E-value 2.3e-92
218497002757	Ribosomal protein S16; Region: Ribosomal_S16; cl00368
218497002758	signal recognition particle protein; Provisional; Region: PRK10867
218497002759	SRP54-type protein, helical bundle domain; Region: SRP54_N; cl03758
218497002760	The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The...; Region: SRP; cd03115
218497002761	P loop; other site
218497002762	GTP binding site [chemical binding]; other site
218497002763	Signal peptide binding domain; Region: SRP_SPB; pfam02978
218497002764	Pfam match to entry PF02978 SRP_SPB, Signal peptide binding domain , score 160.6, E-value 1.8e-45
218497002765	Pfam match to entry PF00448 SRP54, SRP54-type protein, GTPase domain , score 347.3, E-value 1.1e-101
218497002766	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002767	Pfam match to entry PF02881 SRP54_N, SRP54-type protein, helical bundle domain , score 117.0, E-value 2.4e-32
218497002768	N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional; Region: PRK09328
218497002769	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
218497002770	S-adenosylmethionine binding site [chemical binding]; other site
218497002771	peptide chain release factor 1; Validated; Region: prfA; PRK00591
218497002772	RF-1 domain; Region: RF-1; cl02875
218497002773	RF-1 domain; Region: RF-1; cl02875
218497002774	Pfam match to entry PF00472 RF-1, Peptidyl-tRNA hydrolase domain , score 262.4, E-value 4e-76
218497002775	PS00745 Prokaryotic-type class I peptide chain release factors signature.
218497002776	Pfam match to entry PF03462 PCRF, PCRF domain , score 201.8, E-value 7.1e-58
218497002777	Ribosomal protein L31; Region: Ribosomal_L31; cl00377
218497002778	Pfam match to entry PF01197 Ribosomal_L31, Ribosomal protein L31 , score 50.0, E-value 3.3e-12
218497002779	PS01143 Ribosomal protein L31 signature.
218497002780	Signal peptide predicted for CAB632 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.984 between residues 30 and 31
218497002781	9 x poly A tract
218497002782	The S24, S26 LexA/signal peptidase superfamily contains LexA-related and type I signal peptidase families. The S24 LexA protein domains include: the lambda repressor CI/C2 family and related bacterial prophage repressor proteins; LexA (EC 3.4.21.88), the...; Region: Peptidase_S24_S26; cd06462
218497002783	Catalytic site [active]
218497002784	The S26 Type I signal peptidase (SPase; LepB; leader peptidase B; leader peptidase I; EC 3.4.21.89) family members are essential membrane-bound serine proteases that function to cleave the amino-terminal signal peptide extension from proteins that are...; Region: S26_SPase_I; cd06530
218497002785	Pfam match to entry PF00461 Peptidase_S26, Signal peptidase I , score 17.1, E-value 4.5e-06
218497002786	PS00761 Signal peptidases I signature 3.
218497002787	1 probable transmembrane helix predicted for CAB633 by TMHMM2.0 at aa 609-631
218497002788	Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]; Region: IleS; COG0060
218497002789	catalytic core domain of isoleucyl-tRNA synthetases; Region: IleRS_core; cd00818
218497002790	HIGH motif; other site
218497002791	catalytic core domain of isoleucyl-tRNA synthetases; Region: IleRS_core; cd00818
218497002792	active site
218497002793	KMSKS motif; other site
218497002794	Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases; Region: Anticodon_Ia_Ile_ABEc; cd07961
218497002795	tRNA binding surface [nucleotide binding]; other site
218497002796	anticodon binding site; other site
218497002797	isoleucyl-tRNA synthetase; Reviewed; Region: ileS; PRK06039
218497002798	Pfam match to entry PF00133 tRNA-synt_1, tRNA synthetases class I (I, L, M and V) , score 835.7, E-value 1e-248
218497002799	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002800	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
218497002801	NYN ribonuclease and ATPase of PhoH family domains [General    function prediction only]; Region: COG1875
218497002802	PIN domain of bacterial Smg6-like homologs with PhoH-like ATPase domains; Region: PIN_PhoHL-ATPase; cd09883
218497002803	putative active site [active]
218497002804	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002805	Pfam match to entry PF02562 PhoH, PhoH-like protein , score -70.8, E-value 1.8e-10
218497002806	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002807	Pfam match to entry PF01850 PIN, PIN domain , score 16.9, E-value 8.4e-05
218497002808	Bacterial SH3 domain; Region: SH3_3; cl02551
218497002809	Bacterial SH3 domain; Region: SH3_3; cl02551
218497002810	Signal peptide predicted for CAB638 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.998 between residues 24 and 25
218497002811	BNR repeat-like domain; Region: BNR_2; pfam13088
218497002812	Pfam match to entry PF02012 BNR, BNR/Asp-box repeat , score 9.5, E-value 2.1
218497002813	Pfam match to entry PF02012 BNR, BNR/Asp-box repeat , score 12.6, E-value 0.62
218497002814	Pfam match to entry PF02012 BNR, BNR/Asp-box repeat , score 1.4, E-value 28
218497002815	Cytochrome oxidase subunit II; Region: Cyto_ox_2; pfam02322
218497002816	cytochrome d ubiquinol oxidase subunit 2; Provisional; Region: PRK15003; cl12219
218497002817	Pfam match to entry PF02322 Cyto_ox_2, Cytochrome oxidase subunit II , score 496.0, E-value 1.9e-146
218497002818	7 probable transmembrane helices predicted for CAB640 by TMHMM2.0 at aa 79-101, 122-144, 159-181, 202-224, 239-258, 278-300 and 320-342
218497002819	Signal peptide predicted for CAB640 by SignalP 2.0 HMM (Signal peptide probabilty 0.767) with cleavage site probability 0.702 between residues 23 and 24
218497002820	Bacterial Cytochrome Ubiquinol Oxidase; Region: Bac_Ubq_Cox; cl00562
218497002821	Pfam match to entry PF01654 Bac_Ubq_Cox, Bacterial Cytochrome Ubiquinol Oxidase , score 430.9, E-value 7.7e-127
218497002822	9 probable transmembrane helices predicted for CAB641 by TMHMM2.0 at aa 20-42, 55-77, 97-119, 131-153, 189-211, 223-242, 324-346, 359-381 and 409-431
218497002823	Uncharacterized conserved protein [Function unknown]; Region: COG1624
218497002824	DisA bacterial checkpoint controller nucleotide-binding; Region: DisA_N; pfam02457
218497002825	3 probable transmembrane helices predicted for CAB642 by TMHMM2.0 at aa 5-24, 37-59 and 64-86
218497002826	Pfam match to entry PF02457 DUF147, Domain of unknown function DUF147 , score 225.4, E-value 5.6e-65
218497002827	1 probable transmembrane helix predicted for CAB643 by TMHMM2.0 at aa 22-41
218497002828	lipid A biosynthesis lauroyl acyltransferase; Provisional; Region: PRK05906
218497002829	N-Acyltransferase superfamily: Various enyzmes that characteristicly catalyze the transfer of an acyl group to a substrate; Region: NAT_SF; cl00357
218497002830	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like; Region: LPLAT_LABLAT-like; cd07984
218497002831	putative acyl-acceptor binding pocket; other site
218497002832	Pfam match to entry PF03279 Lip_A_acyltrans, Bacterial lipid A biosynthesis acyltransferase , score 362.8, E-value 2.4e-106
218497002833	pyruvate kinase; Provisional; Region: PRK05826
218497002834	Pyruvate kinase (PK):  Large allosteric enzyme that regulates glycolysis through binding of the substrate, phosphoenolpyruvate, and one or more allosteric effectors. Like other allosteric enzymes, PK has a high substrate affinity R state and a low...; Region: Pyruvate_Kinase; cl09155
218497002835	domain interfaces; other site
218497002836	active site
218497002837	Pfam match to entry PF02887 PK_C, Pyruvate kinase, alpha/beta domain , score 54.8, E-value 1.2e-13
218497002838	Pfam match to entry PF00224 PK, Pyruvate kinase, barrel domain , score 410.3, E-value 1.2e-120
218497002839	excinuclease ABC subunit A; Provisional; Region: PRK00635
218497002840	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002841	Walker A/P-loop; other site
218497002842	ATP binding site [chemical binding]; other site
218497002843	Q-loop/lid; other site
218497002844	The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep...; Region: ABC_UvrA_I; cd03270
218497002845	The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep...; Region: ABC_UvrA_II; cd03271
218497002846	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002847	Walker A/P-loop; other site
218497002848	ATP binding site [chemical binding]; other site
218497002849	Q-loop/lid; other site
218497002850	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002851	ATP binding site [chemical binding]; other site
218497002852	Q-loop/lid; other site
218497002853	ABC transporter signature motif; other site
218497002854	Walker B; other site
218497002855	D-loop; other site
218497002856	H-loop/switch region; other site
218497002857	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497002858	Walker A/P-loop; other site
218497002859	ATP binding site [chemical binding]; other site
218497002860	Q-loop/lid; other site
218497002861	ABC transporter signature motif; other site
218497002862	Walker B; other site
218497002863	D-loop; other site
218497002864	H-loop/switch region; other site
218497002865	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 27.4, E-value 2.9e-08
218497002866	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002867	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002868	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 57.5, E-value 1.9e-14
218497002869	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002870	PS00190 Cytochrome c family heme-binding site signature.
218497002871	Pfam match to entry PF00005 ABC_tran, ABC transporter , score 33.3, E-value 1.1e-08
218497002872	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002873	serine/threonine-protein kinase; Reviewed; Region: pknD; PRK13184
218497002874	Catalytic domain of Protein Kinases; Region: PKc; cd00180
218497002875	active site
218497002876	ATP binding site [chemical binding]; other site
218497002877	substrate binding site [chemical binding]; other site
218497002878	activation loop (A-loop); other site
218497002879	Pfam match to entry PF00069 pkinase, Protein kinase domain , score 142.7, E-value 4.4e-40
218497002880	PS00108 Serine/Threonine protein kinases active-site signature.
218497002881	PS00107 Protein kinases ATP-binding region signature.
218497002882	valyl-tRNA synthetase; Reviewed; Region: valS; PRK05729
218497002883	nucleotidyl transferase superfamily; Region: nt_trans; cl00015
218497002884	active site
218497002885	HIGH motif; other site
218497002886	nucleotide binding site [chemical binding]; other site
218497002887	catalytic core domain of valyl-tRNA synthetases; Region: ValRS_core; cd00817
218497002888	active site
218497002889	KMSKS motif; other site
218497002890	Anticodon-binding domain of valyl tRNA synthetases; Region: Anticodon_Ia_Val; cd07962
218497002891	tRNA binding surface [nucleotide binding]; other site
218497002892	anticodon binding site; other site
218497002893	Pfam match to entry PF00133 tRNA-synt_1, tRNA synthetases class I (I, L, M and V) , score 690.9, E-value 4.1e-205
218497002894	PS00178 Aminoacyl-transfer RNA synthetases class-I signature.
218497002895	Signal peptide predicted for CAB649 by SignalP 2.0 HMM (Signal peptide probabilty 0.928) with cleavage site probability 0.765 between residues 38 and 39
218497002896	V-type ATP synthase subunit K; Provisional; Region: PRK09621
218497002897	ATP synthase subunit C; Region: ATP-synt_C; cl00466
218497002898	3 probable transmembrane helices predicted for CAB650 by TMHMM2.0 at aa 33-55, 65-87 and 108-127
218497002899	Signal peptide predicted for CAB650 by SignalP 2.0 HMM (Signal peptide probabilty 0.950) with cleavage site probability 0.728 between residues 21 and 22
218497002900	V-type ATP synthase subunit I; Validated; Region: PRK05771
218497002901	Pfam match to entry PF01496 V_ATPase_sub_a, V-type ATPase 116kDa subunit family , score -105.0, E-value 9.3e-10
218497002902	7 probable transmembrane helices predicted for CAB651 by TMHMM2.0 at aa 317-339, 360-382, 457-479, 486-508, 518-540, 561-583 and 593-615
218497002903	ATP synthase subunit D; Region: ATP-synt_D; cl00613
218497002904	Pfam match to entry PF01813 ATP-synt_D, ATP synthase subunit D , score 155.5, E-value 6e-44
218497002905	V-type ATP synthase subunit B; Provisional; Region: PRK02118
218497002906	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; cl15275
218497002907	V/A-type ATP synthase (non-catalytic) subunit B. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction. The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi...; Region: V_A-ATPase_B; cd01135
218497002908	Walker A motif homologous position; other site
218497002909	Walker B motif; other site
218497002910	Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain , score 283.7, E-value 1.5e-82
218497002911	Pfam match to entry PF02874 ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain , score 58.3, E-value 1.1e-14
218497002912	V-type ATP synthase subunit A; Provisional; Region: PRK04192
218497002913	ATP synthase alpha/beta family, beta-barrel domain; Region: ATP-synt_ab_N; cl15275
218497002914	V/A-type ATP synthase catalytic subunit A. These ATPases couple ATP hydrolysis to the build up of a H+ gradient, but V-type ATPases do not catalyze the reverse reaction.  The Vacuolar (V-type) ATPase is found in the membranes of vacuoles, the golgi...; Region: V_A-ATPase_A; cd01134
218497002915	Walker A motif/ATP binding site; other site
218497002916	Walker B motif; other site
218497002917	ATP synthase alpha/beta chain, C terminal domain; Region: ATP-synt_ab_C; pfam00306
218497002918	Pfam match to entry PF00306 ATP-synt_ab_C, ATP synthase alpha/beta chain, C terminal domain , score 35.0, E-value 1.1e-07
218497002919	Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain , score 496.1, E-value 1.7e-146
218497002920	PS00152 ATP synthase alpha and beta subunits signature.
218497002921	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002922	Pfam match to entry PF02874 ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain , score 42.5, E-value 6.4e-10
218497002923	Protein of unknown function (DUF2764); Region: DUF2764; pfam10962
218497002924	Plant ATP synthase F0; Region: YMF19; cl07975
218497002925	transaldolase-like protein; Provisional; Region: PTZ00411
218497002926	Transaldolases including both TalA and TalB; Region: Transaldolase_TalAB; cd00957
218497002927	active site
218497002928	dimer interface [polypeptide binding]; other site
218497002929	catalytic residue [active]
218497002930	Pfam match to entry PF00923 Transaldolase, Transaldolase , score 409.8, E-value 1.6e-120
218497002931	PS00958 Transaldolase active site.
218497002932	PS01054 Transaldolase signature 1.
218497002933	RNA polymerase Rpb1, domain 1; Region: RNA_pol_Rpb1_1; pfam04997
218497002934	DNA-directed RNA polymerase, beta' subunit, predominant form; Region: rpoC_TIGR; TIGR02386
218497002935	RNA polymerase Rpb1, domain 2; Region: RNA_pol_Rpb1_2; cl11591
218497002936	RNA polymerase Rpb1, domain 3; Region: RNA_pol_Rpb1_3; pfam04983
218497002937	RNA polymerase Rpb1, domain 4; Region: RNA_pol_Rpb1_4; pfam05000
218497002938	Largest subunit of RNA polymerase (RNAP), C-terminal domain; Region: RNAP_largest_subunit_C; cl11429
218497002939	Rpb1 - Rpb6 interaction site [polypeptide binding]; other site
218497002940	bifunctional DNA-directed RNA polymerase subunit beta/beta'; Reviewed; Region: PRK09603
218497002941	Largest subunit (beta') of Bacterial DNA-dependent RNA polymerase (RNAP), C-terminal domain; Region: RNAP_beta'_C; cd02655
218497002942	DNA binding site [nucleotide binding]
218497002943	Rpb1 (beta') - Rpb2 (beta) interaction site [polypeptide binding]; other site
218497002944	Pfam match to entry PF01854 RNA_pol_A2, RNA polymerase A/beta'/A subunit , score 21.5, E-value 1.8e-06
218497002945	Pfam match to entry PF01854 RNA_pol_A2, RNA polymerase A/beta'/A subunit , score 40.1, E-value 8.5e-12
218497002946	Pfam match to entry PF00623 RNA_pol_A, RNA polymerase alpha subunit , score 932.9, E-value 5.7e-278
218497002947	DNA-directed RNA polymerase subunit B''; Validated; Region: PRK09606
218497002948	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cl04593
218497002949	RNA polymerase beta subunit; Region: RNA_pol_Rpb2_1; cl04591
218497002950	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cd00653
218497002951	RPB12 interaction site [polypeptide binding]; other site
218497002952	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cl04593
218497002953	RPB11 interaction site [polypeptide binding]; other site
218497002954	RPB12 interaction site [polypeptide binding]; other site
218497002955	RNA polymerase beta subunit. RNA polymerases catalyse the DNA dependent polymerization of RNA. Prokaryotes contain a single RNA polymerase compared to three in eukaryotes (not including mitochondrial. and chloroplast polymerases). Each RNA polymerase...; Region: RNA_pol_B_RPB2; cd00653
218497002956	RPB3 interaction site [polypeptide binding]; other site
218497002957	RPB1 interaction site [polypeptide binding]; other site
218497002958	RPB11 interaction site [polypeptide binding]; other site
218497002959	RPB10 interaction site [polypeptide binding]; other site
218497002960	Pfam match to entry PF00562 RNA_pol_B, RNA polymerase beta subunit , score 1826.4, E-value 0
218497002961	PS00017 ATP/GTP-binding site motif A (P-loop).
218497002962	PS01166 RNA polymerases beta chain signature.
218497002963	Ribosomal protein L7/L12. Ribosomal protein L7/L12 refers to the large ribosomal subunit proteins L7 and L12, which are identical except that L7 is acetylated at the N terminus. It is a component of the L7/L12 stalk, which is located at the surface of...; Region: Ribosomal_L7_L12; cd00387
218497002964	L11 interface [polypeptide binding]; other site
218497002965	putative EF-Tu interaction site [polypeptide binding]; other site
218497002966	putative EF-G interaction site [polypeptide binding]; other site
218497002967	Pfam match to entry PF00542 Ribosomal_L12, Ribosomal protein L7/L12 C-terminal domain , score 136.2, E-value 3.9e-38
218497002968	Ribosomal protein L10 family, L10 subfamily; composed of bacterial 50S ribosomal protein and eukaryotic mitochondrial 39S ribosomal protein, L10. L10 occupies the L7/L12 stalk of the ribosome. The N-terminal domain (NTD) of L10 interacts with L11 protein...; Region: Ribosomal_L10; cd05797
218497002969	23S rRNA interface [nucleotide binding]; other site
218497002970	Interface with L7/L12 ribosomal proteins [polypeptide binding]; other site
218497002971	Pfam match to entry PF00466 Ribosomal_L10, Ribosomal protein L10 , score 9.0, E-value 7.9e-05
218497002972	Ribosomal protein L1.  The L1 protein, located near the E-site of the ribosome, forms part of the L1 stalk along with 23S rRNA.  In bacteria and archaea, L1 functions both as a ribosomal protein that binds rRNA, and as a translation repressor that binds...; Region: Ribosomal_L1; cd00403
218497002973	mRNA/rRNA interface [nucleotide binding]; other site
218497002974	Pfam match to entry PF00687 Ribosomal_L1, Ribosomal protein L1p/L10e family , score 355.6, E-value 3.5e-104
218497002975	50S ribosomal protein L11; Validated; Region: rplK; PRK00140
218497002976	Ribosomal protein L11. Ribosomal protein L11, together with proteins L10 and L7/L12, and 23S rRNA, form the L7/L12 stalk on the surface of the large subunit of the ribosome. The homologous eukaryotic cytoplasmic protein is also called 60S ribosomal...; Region: Ribosomal_L11; cd00349
218497002977	23S rRNA interface [nucleotide binding]; other site
218497002978	L7/L12 interface [polypeptide binding]; other site
218497002979	putative thiostrepton binding site; other site
218497002980	L25 interface [polypeptide binding]; other site
218497002981	Pfam match to entry PF00298 Ribosomal_L11, Ribosomal protein L11, RNA binding domain , score 113.8, E-value 2.1e-31
218497002982	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00359 Ribosomal protein L11 signature.
218497002983	Pfam match to entry PF03946 Ribosomal_L11_N, Ribosomal protein L11, N-terminal domain , score 114.2, E-value 1.6e-31
218497002984	transcription antitermination protein NusG; Validated; Region: nusG; PRK05609
218497002985	Bacterial N-Utilization Substance G (NusG) N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1; cd09891
218497002986	putative homodimer interface [polypeptide binding]; other site
218497002987	Pfam match to entry PF00467 KOW, KOW motif , score 34.5, E-value 1.6e-07
218497002988	Pfam match to entry PF02357 NusG, Transcription termination factor nusG , score 77.4, E-value 1.9e-20
218497002989	SecE/Sec61-gamma subunits of protein translocation complex; Region: SecE; cl00481
218497002990	1 probable transmembrane helix predicted for CAB667 by TMHMM2.0 at aa 45-67
218497002991	elongation factor Tu; Reviewed; Region: PRK12735
218497002992	EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors; Region: EF_Tu; cd01884
218497002993	G1 box; other site
218497002994	GEF interaction site [polypeptide binding]; other site
218497002995	GTP/Mg2+ binding site [chemical binding]; other site
218497002996	Switch I region; other site
218497002997	G2 box; other site
218497002998	G3 box; other site
218497002999	Switch II region; other site
218497003000	G4 box; other site
218497003001	G5 box; other site
218497003002	EFTU_II: Elongation factor Tu domain II. Elongation factors Tu (EF-Tu) are three-domain GTPases with an essential function in the elongation phase of mRNA translation. The GTPase center of EF-Tu is in the N-terminal domain (domain I), also known as the...; Region: EFTU_II; cd03697
218497003003	Domain III of elongation factor (EF) Tu. Ef-Tu consists of three structural domains, designated I, II and III. Domain III adopts a beta barrel structure. Domain III is involved in binding to both charged tRNA and binding to elongation factor Ts (EF-Ts); Region: EFTU_III; cd03707
218497003004	Antibiotic Binding Site [chemical binding]; other site
218497003005	Pfam match to entry PF03143 GTP_EFTU_D3, Elongation factor Tu C-terminal domain , score 200.0, E-value 2.4e-57
218497003006	Pfam match to entry PF03144 GTP_EFTU_D2, Elongation factor Tu domain 2 , score 113.3, E-value 2.9e-31
218497003007	Pfam match to entry PF00009 GTP_EFTU, Elongation factor Tu GTP binding domain , score 325.0, E-value 5.7e-95
218497003008	PS00301 GTP-binding elongation factors signature.
218497003009	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003010	S1_IF1: Translation Initiation Factor IF1, S1-like RNA-binding domain. IF1 contains an S1-like RNA-binding domain, which is found in a wide variety of RNA-associated proteins. Translation initiation includes a number of interrelated steps preceding the...; Region: S1_IF1; cd04451
218497003011	rRNA binding site [nucleotide binding]; other site
218497003012	predicted 30S ribosome binding site; other site
218497003013	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 32.4, E-value 6.6e-07
218497003014	3 probable transmembrane helices predicted for CAB670 by TMHMM2.0 at aa 93-110, 115-137 and 168-190
218497003015	Fe-S metabolism associated domain; Region: SufE; cl00951
218497003016	Pfam match to entry PF02657 UPF0050, Domain of unknown function DUF , score 178.7, E-value 6.3e-51
218497003017	Protein of unknown function (DUF1393); Region: DUF1393; cl01942
218497003018	Pfam match to entry PF02632 BioY, BioY family , score 85.5, E-value 7.1e-23
218497003019	5 probable transmembrane helices predicted for CAB672 by TMHMM2.0 at aa 25-47, 52-74, 89-111, 123-145 and 160-182
218497003020	homopolymeric tract of 12 A residues
218497003021	Protein of unknown function (DUF687); Region: DUF687; pfam05095
218497003022	5 probable transmembrane helices predicted for CAB675 by TMHMM2.0 at aa 344-366, 378-395, 410-432, 470-492 and 538-560
218497003023	11 x poly G tract. Possible site for phase variation
218497003024	dihydrodipicolinate synthase; Region: dapA; TIGR00674
218497003025	Dihydrodipicolinate synthase (DHDPS); Region: DHDPS; cd00950
218497003026	dimer interface [polypeptide binding]; other site
218497003027	active site
218497003028	catalytic residue [active]
218497003029	Pfam match to entry PF00701 DHDPS, Dihydrodipicolinate synthetase , score 103.2, E-value 3.3e-28
218497003030	PS00665 Dihydrodipicolinate synthetase signature 1.
218497003031	aspartate kinase; Provisional; Region: PRK05925
218497003032	AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH). These aspartokinases are found in such...; Region: AAK_AK-HSDH-like; cd04243
218497003033	putative catalytic residues [active]
218497003034	nucleotide binding site [chemical binding]; other site
218497003035	aspartate binding site [chemical binding]; other site
218497003036	Pfam match to entry PF00696 aakinase, Amino acid kinase , score 159.5, E-value 3.8e-45
218497003037	PS00324 Aspartokinase signature.
218497003038	aspartate-semialdehyde dehydrogenase; Reviewed; Region: PRK08664
218497003039	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003040	Semialdehyde dehydrogenase, dimerisation domain; Region: Semialdhyde_dhC; pfam02774
218497003041	Pfam match to entry PF02774 Semialdhyde_dhC, Semialdehyde dehydrogenase, dimerisation domain , score 122.7, E-value 4.4e-34
218497003042	Pfam match to entry PF01118 Semialdhyde_dh, Semialdehyde dehydrogenase, NAD binding domain , score 56.3, E-value 4.4e-14
218497003043	dihydrodipicolinate reductase; Provisional; Region: PRK00048
218497003044	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003045	Dihydrodipicolinate reductase, C-terminus; Region: DapB_C; pfam05173
218497003046	Pfam match to entry PF01113 DapB, Dihydrodipicolinate reductase , score 39.3, E-value 3.7e-11
218497003047	Biopterin-dependent aromatic amino acid hydroxylase; a family of non-heme, iron(II)-dependent enzymes that includes prokaryotic and eukaryotic phenylalanine-4-hydroxylase (PheOH), eukaryotic tyrosine hydroxylase (TyrOH) and eukaryotic tryptophan...; Region: arom_aa_hydroxylase; cd00361
218497003048	cofactor binding site; other site
218497003049	metal binding site [ion binding]; metal-binding site
218497003050	Pfam match to entry PF00351 biopterin_H, Biopterin-dependent aromatic amino acid hydroxylase , score -205.1, E-value 0.0002
218497003051	Uncharacterized ACR, YhhQ family COG1738; Region: DUF165; cl00756
218497003052	Pfam match to entry PF02592 DUF165, Uncharacterized ACR, YhhQ family COG1738 , score 122.5, E-value 5e-34
218497003053	Signal peptide predicted for CAB682 by SignalP 2.0 HMM (Signal peptide probabilty 0.989) with cleavage site probability 0.665 between residues 27 and 28
218497003054	5 probable transmembrane helices predicted for CAB682 by TMHMM2.0 at aa 34-56, 69-91, 106-128, 148-170 and 180-202
218497003055	Ulp1 protease family, C-terminal catalytic domain; Region: Peptidase_C48; pfam02902
218497003056	1 probable transmembrane helix predicted for CAB683 by TMHMM2.0 at aa 57-79
218497003057	3-ketoacyl-(acyl-carrier-protein) reductase; Provisional; Region: fabG; PRK05565
218497003058	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003059	NAD(P) binding site [chemical binding]; other site
218497003060	active site
218497003061	Pfam match to entry PF00106 adh_short, short chain dehydrogenase , score 38.8, E-value 8e-10
218497003062	Biotin synthase and related enzymes [Coenzyme metabolism]; Region: BioB; COG0502
218497003063	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497003064	FeS/SAM binding site; other site
218497003065	Biotin and Thiamin Synthesis associated domain; Region: BATS; cl06149
218497003066	Pfam match to entry PF01792 Biotin_synth, Biotin synthase , score 623.1, E-value 1.1e-184
218497003067	pyridoxal phosphate-dependent acyltransferase, putative; Region: gly_Cac_T_rel; TIGR01825
218497003068	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
218497003069	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
218497003070	catalytic residue [active]
218497003071	Pfam match to entry PF00155 aminotran_1_2, Aminotransferase class I and II , score 87.0, E-value 2.5e-23
218497003072	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
218497003073	adenosylmethionine-8-amino-7-oxononanoate transaminase; Region: PLN02974
218497003074	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497003075	This hit extended beyond the end of the feature by 1 aa and was clipped.; PS00294 Prenyl group binding site (CAAX box).
218497003076	adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional; Region: PRK05964
218497003077	Acetyl ornithine aminotransferase family. This family belongs to pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I). The major groups in this CD correspond to ornithine aminotransferase, acetylornithine aminotransferase; Region: OAT_like; cd00610
218497003078	inhibitor-cofactor binding pocket; inhibition site
218497003079	pyridoxal 5'-phosphate binding site [chemical binding]; other site
218497003080	catalytic residue [active]
218497003081	Pfam match to entry PF00202 aminotran_3, Aminotransferase class-III , score 305.3, E-value 4.7e-89
218497003082	PS00600 Aminotransferases class-III pyridoxal-phosphate attachment site.
218497003083	EPSP synthase domain. 3-phosphoshikimate 1-carboxyvinyltransferase (5-enolpyruvylshikimate-3-phosphate synthase) (EC 2.5.1.19) catalyses the reaction between shikimate-3-phosphate (S3P) and phosphoenolpyruvate (PEP) to form...; Region: EPSP_synthase; cd01556
218497003084	3-phosphoshikimate 1-carboxyvinyltransferase; Region: aroA; TIGR01356
218497003085	hinge; other site
218497003086	active site
218497003087	Pfam match to entry PF00275 EPSP_syntase, EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) , score 422.4, E-value 2.6e-124
218497003088	PS00885 EPSP synthase signature 2.
218497003089	Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants. Chorismic acid is a important intermediate in the synthesis...; Region: SK; cd00464
218497003090	ADP binding site [chemical binding]; other site
218497003091	magnesium binding site [ion binding]; other site
218497003092	putative shikimate binding site; other site
218497003093	Pfam match to entry PF01202 SKI, Shikimate kinase , score 44.4, E-value 1.7e-10
218497003094	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003095	Chorismase synthase, the enzyme catalyzing the final step of the shikimate pathway; Region: Chorismate_synthase; cd07304
218497003096	Tetramer interface [polypeptide binding]; other site
218497003097	active site
218497003098	FMN-binding site [chemical binding]; other site
218497003099	Pfam match to entry PF01264 Chorismate_synt, Chorismate synthase , score 445.2, E-value 3.7e-131
218497003100	PS00787 Chorismate synthase signature 1.
218497003101	PS00788 Chorismate synthase signature 2.
218497003102	PS00789 Chorismate synthase signature 3.
218497003103	Dehydroquinate synthase (DHQS) catalyzes the conversion of DAHP to DHQ in shikimate pathway for aromatic compounds synthesis; Region: DHQS; cd08195
218497003104	active site
218497003105	dimer interface [polypeptide binding]; other site
218497003106	metal binding site [ion binding]; metal-binding site
218497003107	Pfam match to entry PF01761 DHQ_synthase, 3-dehydroquinate synthase , score 306.8, E-value 1.7e-89
218497003108	bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed; Region: aroDE; PRK09310
218497003109	Type I 3-dehydroquinase, (3-dehydroquinate dehydratase or DHQase); Region: DHQase_I; cd00502
218497003110	active site
218497003111	catalytic residue [active]
218497003112	dimer interface [polypeptide binding]; other site
218497003113	Shikimate dehydrogenase substrate binding domain; Region: Shikimate_dh_N; pfam08501
218497003114	NAD(P) binding domain of Shikimate dehydrogenase; Region: NAD_bind_Shikimate_DH; cd01065
218497003115	shikimate binding site; other site
218497003116	NAD(P) binding site [chemical binding]; other site
218497003117	Pfam match to entry PF01487 DHquinase_I, Type I 3-dehydroquinase , score 111.8, E-value 8.4e-31
218497003118	Pfam match to entry PF01488 Shikimate_DH, Shikimate / quinate 5-dehydrogenase , score 170.1, E-value 2.4e-48
218497003119	Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl11391
218497003120	Carbohydrate-selective porin, OprB family; Region: OprB; pfam04966
218497003121	Carbohydrate-selective porin [Cell envelope biogenesis, outer membrane]; Region: OprB; COG3659
218497003122	Signal peptide predicted for CAB696 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 1.000 between residues 24 and 25
218497003123	Pyruvoyl-dependent arginine decarboxylase (PvlArgDC); Region: PvlArgDC; cl00849
218497003124	Amino acid permease; Region: AA_permease; cl00524
218497003125	Signal peptide predicted for CAB698 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.442 between residues 38 and 39
218497003126	Pfam match to entry PF00324 aa_permeases, Amino acid permease , score -209.5, E-value 9.4e-05
218497003127	11 probable transmembrane helices predicted for CAB698 by TMHMM2.0 at aa 39-61, 90-112, 127-149, 156-178, 212-231, 244-266, 292-314, 341-360, 365-387, 408-442 and 462-481
218497003128	Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism]; Region: DadA; COG0665
218497003129	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003130	Pfam match to entry PF01266 DAO, FAD dependent oxidoreductase , score 199.9, E-value 2.6e-57
218497003131	6 probable transmembrane helices predicted for CAB700 by TMHMM2.0 at aa 21-40, 55-77, 100-122, 142-164, 194-216 and 236-258
218497003132	malate dehydrogenase; Provisional; Region: PRK05442
218497003133	Chloroplast-like malate dehydrogenases; Region: MDH_choloroplast_like; cd01338
218497003134	NAD(P) binding site [chemical binding]; other site
218497003135	dimer interface [polypeptide binding]; other site
218497003136	malate binding site [chemical binding]; other site
218497003137	Pfam match to entry PF02866 ldh_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain , score 83.8, E-value 2.3e-22
218497003138	Pfam match to entry PF00056 ldh, lactate/malate dehydrogenase, NAD binding domain , score 128.9, E-value 6.1e-36
218497003139	Signal peptide predicted for CAB701 by SignalP 2.0 HMM (Signal peptide probabilty 0.666) with cleavage site probability 0.324 between residues 29 and 30
218497003140	glucose-6-phosphate isomerase; Provisional; Region: pgi; PRK14095
218497003141	Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains. This classification is based on the alignment of the first SIS domain. PGI is a multifunctional enzyme which as an intracellular dimer catalyzes the reversible isomerization of...; Region: SIS_PGI_1; cd05015
218497003142	active site
218497003143	dimer interface [polypeptide binding]; other site
218497003144	Phosphoglucose isomerase (PGI) contains two SIS (Sugar ISomerase) domains. This classification is based on the alignment of the second SIS domain. PGI is a multifunctional enzyme which as an intracellular dimer catalyzes the reversible isomerization of...; Region: SIS_PGI_2; cd05016
218497003145	dimer interface [polypeptide binding]; other site
218497003146	active site
218497003147	Pfam match to entry PF00342 PGI, Phosphoglucose isomerase , score 428.7, E-value 3.3e-126
218497003148	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003149	site-specific tyrosine recombinase XerD; Reviewed; Region: xerD; PRK00283
218497003150	DNA breaking-rejoining enzymes, C-terminal catalytic domain. The DNA breaking-rejoining enzyme superfamily includes type IB topoisomerases and tyrosine recombinases that share the same fold in their catalytic domain containing six conserved active site...; Region: DNA_BRE_C; cl00213
218497003151	DNA binding site [nucleotide binding]
218497003152	Int/Topo IB signature motif; other site
218497003153	active site
218497003154	Pfam match to entry PF02899 Phage_integr_N, Phage integrase, N-terminal SAM-like domain , score 95.0, E-value 9.4e-26
218497003155	Pfam match to entry PF00589 Phage_integrase, Phage integrase , score 144.0, E-value 1.7e-40
218497003156	Signal peptide predicted for CAB705 by SignalP 2.0 HMM (Signal peptide probability 1.000) with cleavage site probability 0.662 between residues 27 and 28
218497003157	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497003158	type III secretion low calcium response chaperone LcrH/SycD; Region: LcrH_SycD; TIGR02552
218497003159	3 probable transmembrane helices predicted for CAB708 by TMHMM2.0 at aa 342-364, 385-407 and 422-441
218497003160	Predicted helix-turn-helix motif with score 990.000, SD 2.56 at aa 358-379, sequence ESQAKLSQWLGIATATLGILGA
218497003161	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003162	LytB protein; Region: LYTB; cl00507
218497003163	(E)-4-hydroxy-3-methyl-but-2-enyl pyrophosphate reductase (IPP and DMAPP forming); Region: ispH_lytB; TIGR00216
218497003164	Pfam match to entry PF02401 LYTB, LytB protein , score 541.3, E-value 4.4e-160
218497003165	C-terminal processing peptidase family S41; Region: Peptidase_S41; cl02526
218497003166	Active site serine [active]
218497003167	PS00037 Myb DNA-binding domain repeat signature 1.
218497003168	Signal peptide predicted for CAB712 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.880 between residues 23 and 24
218497003169	Na+/H+ antiporter NhaD and related arsenite permeases [Inorganic ion transport and metabolism]; Region: ArsB; COG1055
218497003170	Anion permease ArsB/NhaD.  These permeases have been shown to translocate sodium, arsenate, antimonite, sulfate and organic anions across biological membranes in all three kingdoms of life.  A typical anion permease contains 8-13 transmembrane helices...; Region: ArsB_NhaD_permease; cl15357
218497003171	transmembrane helices; other site
218497003172	12 probable transmembrane helices predicted for CAB713 by TMHMM2.0 at aa 7-24, 29-46, 53-75, 104-126, 138-157, 177-199, 220-237, 242-264, 285-307, 322-344, 357-379 and 394-413
218497003173	high affinity sulphate transporter 1; Region: sulP; TIGR00815
218497003174	Permease family; Region: Xan_ur_permease; cl00967
218497003175	Sulphate Transporter and Anti-Sigma factor antagonist domain of SulP-like sulfate transporters, plays a role in the function and regulation of the transport activity, proposed general NTP binding function; Region: STAS_SulP_like_sulfate_transporter; cd07042
218497003176	11 probable transmembrane helices predicted for CAB714 by TMHMM2.0 at aa 66-88, 92-111, 113-135, 139-161, 168-185, 211-233, 240-257, 291-313, 326-348, 368-399 and 420-442
218497003177	Pfam match to entry PF00916 Sulfate_transp, Sulfate transporter family , score 224.9, E-value 7.5e-65
218497003178	Pfam match to entry PF01740 STAS, STAS domain , score 84.1, E-value 1.8e-22
218497003179	fumarate hydratase; Reviewed; Region: fumC; PRK00485
218497003180	Class II fumarases; Region: Fumarase_classII; cd01362
218497003181	active site
218497003182	tetramer interface [polypeptide binding]; other site
218497003183	Pfam match to entry PF00206 lyase_1, Lyase , score 546.3, E-value 1.4e-161
218497003184	PS00163 Fumarate lyases signature.
218497003185	ABC-type nitrate/sulfonate/bicarbonate transport system, permease component [Inorganic ion transport and metabolism]; Region: TauC; COG0600
218497003186	Transmembrane subunit (TM) found in Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which generally bind type 2 PBPs. These types of transporters consist of a PBP, two TMs, and two cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2; cd06261
218497003187	dimer interface [polypeptide binding]; other site
218497003188	conserved gate region; other site
218497003189	putative PBP binding loops; other site
218497003190	ABC-ATPase subunit interface; other site
218497003191	NMT1/THI5 like; Region: NMT1; pfam09084
218497003192	Tripartite tricarboxylate transporter family receptor; Region: TctC; cl15260
218497003193	5 probable transmembrane helices predicted for CAB716 by TMHMM2.0 at aa 25-42, 78-100, 112-134, 138-160 and 237-256
218497003194	adenylate kinases; Region: adk; TIGR01351
218497003195	Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP). This enzyme is required for the biosynthesis of ADP and is essential for...; Region: ADK; cd01428
218497003196	AMP-binding site [chemical binding]; other site
218497003197	ATP-AMP (Ap5A)-binding site [chemical binding]; other site
218497003198	Pfam match to entry PF00406 adenylatekinase, Adenylate kinase , score -42.4, E-value 1.9e-08
218497003199	MarC family integral membrane protein; Region: MarC; cl00919
218497003200	Pfam match to entry PF01914 MarC, MarC family integral membrane protein , score -14.4, E-value 2.3e-07
218497003201	5 probable transmembrane helices predicted for CAB718 by TMHMM2.0 at aa 5-27, 48-67, 111-133, 142-164 and 179-201
218497003202	MarC family integral membrane protein; Region: MarC; cl00919
218497003203	Pfam match to entry PF01914 MarC, MarC family integral membrane protein , score 183.3, E-value 2.6e-52
218497003204	6 probable transmembrane helices predicted for CAB719 by TMHMM2.0 at aa 2-24, 39-57, 69-91, 106-128, 137-159 and 174-196
218497003205	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497003206	methionine aminopeptidase; Provisional; Region: PRK12318
218497003207	SEC-C motif; Region: SEC-C; pfam02810
218497003208	Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also known as methionyl aminopeptidase and Peptidase M. Catalyzes release of N-terminal amino acids, preferentially methionine, from peptides and arylamides; Region: MetAP1; cd01086
218497003209	active site
218497003210	Pfam match to entry PF02810 SEC-C, SEC-C motif , score 32.0, E-value 8.9e-07
218497003211	Pfam match to entry PF00557 Peptidase_M24, metallopeptidase M24 , score 227.7, E-value 1.1e-65
218497003212	PS00680 Methionine aminopeptidase subfamily 1 signature.
218497003213	3 probable transmembrane helices predicted for CAB721 by TMHMM2.0 at aa 39-61, 76-98 and 105-127
218497003214	Protein of unknown function (DUF720); Region: DUF720; pfam05302
218497003215	Protein of unknown function (DUF720); Region: DUF720; pfam05302
218497003216	Protein of unknown function (DUF720); Region: DUF720; pfam05302
218497003217	3 probable transmembrane helices predicted for CAB726 by TMHMM2.0 at aa 115-137, 147-165 and 186-208
218497003218	Nucleoside deaminases include adenosine, guanine and cytosine deaminases. These enzymes are Zn dependent and catalyze the deamination of nucleosides. The zinc ion in the active site plays a central role in the proposed catalytic mechanism, activating a...; Region: nucleoside_deaminase; cd01285
218497003219	nucleoside/Zn binding site; other site
218497003220	dimer interface [polypeptide binding]; other site
218497003221	catalytic motif [active]
218497003222	Pfam match to entry PF00383 dCMP_cyt_deam, Cytidine and deoxycytidylate deaminase zinc-binding region , score 122.4, E-value 5.4e-34
218497003223	Ribosomal protein S15 (prokaryotic)_S13 (eukaryotic) binds the central domain of 16S rRNA and is required for assembly of the small ribosomal subunit and for intersubunit association, thus representing a key element in the assembly of the whole ribosome; Region: Ribosomal_S15p_S13e; cd00353
218497003224	16S/18S rRNA binding site [nucleotide binding]; other site
218497003225	S13e-L30e interaction site [polypeptide binding]; other site
218497003226	25S rRNA binding site [nucleotide binding]; other site
218497003227	Pfam match to entry PF00312 Ribosomal_S15, Ribosomal protein S15 , score 102.4, E-value 5.6e-28
218497003228	PS00362 Ribosomal protein S15 signature.
218497003229	polynucleotide phosphorylase/polyadenylase; Provisional; Region: PRK11824
218497003230	3' exoribonuclease family, domain 1; Region: RNase_PH; pfam01138
218497003231	3' exoribonuclease family, domain 2; Region: RNase_PH_C; pfam03725
218497003232	Polyribonucleotide nucleotidyltransferase, RNA binding domain; Region: PNPase; pfam03726
218497003233	3' exoribonuclease family, domain 1; Region: RNase_PH; pfam01138
218497003234	3' exoribonuclease family, domain 2; Region: RNase_PH_C; pfam03725
218497003235	Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH). PNPase is a polyribonucleotide nucleotidyl transferase that degrades mRNA in prokaryotes and plant chloroplasts. The C-terminal region of PNPase contains domains homologous to...; Region: PNPase_KH; cd02393
218497003236	putative nucleic acid binding region [nucleotide binding]; other site
218497003237	G-X-X-G motif; other site
218497003238	S1_PNPase: Polynucleotide phosphorylase (PNPase), ), S1-like RNA-binding domain. PNPase  is a polyribonucleotide nucleotidyl transferase that degrades mRNA. It is a trimeric multidomain protein. The C-terminus contains the S1 domain which binds ssRNA; Region: S1_PNPase; cd04472
218497003239	RNA binding site [nucleotide binding]; other site
218497003240	domain interface; other site
218497003241	Pfam match to entry PF01138 RNase_PH, 3' exoribonuclease, domain 1 , score 100.0, E-value 2.9e-27
218497003242	Pfam match to entry PF03725 RNase_PH_C, 3' exoribonuclease, domain 2 , score 57.9, E-value 1.5e-14
218497003243	Pfam match to entry PF03726 PNPase, Polyribonucleotide nucleotidyltransferase, RNA binding domain , score 10.5, E-value 0.00017
218497003244	Pfam match to entry PF01138 RNase_PH, 3' exoribonuclease, domain 1 , score 157.1, E-value 2e-44
218497003245	Pfam match to entry PF03725 RNase_PH_C, 3' exoribonuclease, domain 2 , score 88.8, E-value 7.2e-24
218497003246	Pfam match to entry PF00013 KH, KH domain , score 40.3, E-value 2.8e-09
218497003247	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 72.5, E-value 5.7e-19
218497003248	ATP-dependent metalloprotease FtsH; Region: FtsH_fam; TIGR01241
218497003249	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497003250	Walker A motif; other site
218497003251	ATP binding site [chemical binding]; other site
218497003252	Walker B motif; other site
218497003253	arginine finger; other site
218497003254	Peptidase family M41; Region: Peptidase_M41; pfam01434
218497003255	Pfam match to entry PF01434 Peptidase_M41, Peptidase M41 , score 411.4, E-value 5.4e-121
218497003256	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 312.3, E-value 3.8e-91
218497003257	PS00674 AAA-protein family signature.
218497003258	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003259	Probable transmembrane helices predicted for CAB731 by TMHMM2.0 at aa 372-394
218497003260	Signal peptide predicted for CAB731 by SignalP 2.0 HMM (Signal peptide probabilty 0.971) with cleavage site probability 0.803 between residues 32 and 33
218497003261	N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning]. This is a subfamily of Adenine nucleotide alpha hydrolases superfamily.Adeninosine nucleotide alpha hydrolases...; Region: PP-ATPase; cd01992
218497003262	Ligand Binding Site [chemical binding]; other site
218497003263	Predicted permeases [General function prediction only]; Region: COG0795; cl12074
218497003264	Predicted permease YjgP/YjgQ family; Region: YjgP_YjgQ; pfam03739
218497003265	Signal peptide predicted for CAB733 by SignalP 2.0 HMM (Signal peptide probabilty 0.872) with cleavage site probability 0.376 between residues 33 and 34
218497003266	Pfam match to entry PF03739 YjgP_YjgQ, Predicted permease YjgP/YjgQ family , score 217.1, E-value 1.7e-62
218497003267	5 probable transmembrane helices predicted for CAB733 by TMHMM2.0 at aa 54-76, 96-118, 277-296, 303-320 and 325-347
218497003268	Predicted permeases [General function prediction only]; Region: COG0795; cl12074
218497003269	Predicted permease YjgP/YjgQ family; Region: YjgP_YjgQ; pfam03739
218497003270	Signal peptide predicted for CAB734 by SignalP 2.0 HMM (Signal peptide probabilty 0.973) with cleavage site probability 0.373 between residues 45 and 46
218497003271	Pfam match to entry PF03739 YjgP_YjgQ, Predicted permease YjgP/YjgQ family , score 179.4, E-value 3.9e-51
218497003272	5 probable transmembrane helices predicted for CAB734 by TMHMM2.0 at aa 54-76, 97-119, 281-303, 315-337 and 342-364
218497003273	phenylalanyl-tRNA synthetase subunit alpha; Validated; Region: pheS; PRK00488
218497003274	Aminoacyl tRNA synthetase class II, N-terminal domain; Region: Phe_tRNA-synt_N; pfam02912
218497003275	Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain. PheRS belongs to class II aminoacyl-tRNA synthetases (aaRS) based upon its structure and the presence of three characteristic sequence motifs. This domain is primarily responsible...; Region: PheRS_alpha_core; cd00496
218497003276	motif 1; other site
218497003277	dimer interface [polypeptide binding]; other site
218497003278	active site
218497003279	motif 2; other site
218497003280	motif 3; other site
218497003281	Pfam match to entry PF01409 tRNA-synt_2d, tRNA synthetases class II core domain (F) , score 403.4, E-value 1.4e-118
218497003282	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497003283	PS00197 2Fe-2S ferredoxins, iron-sulfur binding region signature.
218497003284	Pfam match to entry PF02912 Phe_tRNA-synt_N, Aminoacyl tRNA synthetase class II, N-terminal domain , score 102.9, E-value 4e-28
218497003285	ribosomal protein L20; Region: rpl20; CHL00068
218497003286	Ribosomal protein L20; Region: Ribosomal_L20; cd07026
218497003287	23S rRNA binding site [nucleotide binding]; other site
218497003288	L21 binding site [polypeptide binding]; other site
218497003289	L13 binding site [polypeptide binding]; other site
218497003290	Pfam match to entry PF00453 Ribosomal_L20, Ribosomal protein L20 , score 121.0, E-value 1.5e-33
218497003291	PS00937 Ribosomal protein L20 signature.
218497003292	Ribosomal protein L35; Region: Ribosomal_L35p; cl00392
218497003293	Pfam match to entry PF01632 Ribosomal_L35p, Ribosomal protein L35 , score 49.9, E-value 3.6e-12
218497003294	translation initiation factor IF-3; Reviewed; Region: infC; PRK00028
218497003295	Translation initiation factor IF-3, N-terminal domain; Region: IF3_N; pfam05198
218497003296	Translation initiation factor IF-3, C-terminal domain; Region: IF3_C; pfam00707
218497003297	Pfam match to entry PF00707 IF3, Translation initiation factor IF-3 , score 357.0, E-value 1.3e-104
218497003298	Transcription termination factor NusB (N protein-Utilization Substance B). NusB plays a key role in the regulation of ribosomal RNA biosynthesis in eubacteria by modulating the efficiency of transcriptional antitermination. NusB along with other Nus...; Region: Terminator_NusB; cd00619
218497003299	putative RNA binding site [nucleotide binding]; other site
218497003300	Pfam match to entry PF01029 NusB, NusB family , score 124.6, E-value 1.2e-34
218497003301	UDP-N-acetylenolpyruvoylglucosamine reductase; Provisional; Region: murB; PRK13905
218497003302	FAD binding domain; Region: FAD_binding_4; pfam01565
218497003303	UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain; Region: MurB_C; pfam02873
218497003304	Pfam match to entry PF01565 FAD_binding_4, FAD binding domain , score 27.9, E-value 2e-06
218497003305	Pfam match to entry PF02873 MurB_C, UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain , score 182.0, E-value 6.3e-52
218497003306	Pseudogene. Similar to Oceanobacillus iheyensis hypothetical conserved protein OB2308 SWALL:Q8EP11 (EMBL:AP004600) (191 aa) fasta scores: E(): 2.7e-14, 31.35% id in 185 aa, and to Neisseria meningitidis hypothetical protein NMB0747 SWALL:Q9K071 (EMBL:AE002429) (188 aa) fasta scores: E(): 1.7e-12, 33.51% id in 188 aa. Note contains a frameshift after residue 118;conserved hypothetical protein (pseudogene)
218497003307	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl12011
218497003308	Pfam match to entry PF02390 Methyltransf_4, methyltransferase , score 260.1, E-value 1.9e-75
218497003309	Ribonucleotide Reductase, R2/beta subunit, ferritin-like diiron-binding domain; Region: RNRR2; cd01049
218497003310	dimer interface [polypeptide binding]; other site
218497003311	putative radical transfer pathway; other site
218497003312	diiron center [ion binding]; other site
218497003313	tyrosyl radical; other site
218497003314	Pfam match to entry PF00268 ribonuc_red_sm, Ribonucleotide reductase, small chain , score 136.4, E-value 3.3e-38
218497003315	1 probable transmembrane helix predicted for CAB744 by TMHMM2.0 at aa 188-210
218497003316	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003317	ribonucleotide-diphosphate reductase subunit alpha; Provisional; Region: PRK12365
218497003318	ATP cone domain; Region: ATP-cone; pfam03477
218497003319	ATP cone domain; Region: ATP-cone; pfam03477
218497003320	ATP cone domain; Region: ATP-cone; pfam03477
218497003321	Class I ribonucleotide reductase; Region: RNR_I; cd01679
218497003322	active site
218497003323	dimer interface [polypeptide binding]; other site
218497003324	catalytic residues [active]
218497003325	effector binding site; other site
218497003326	R2 peptide binding site; other site
218497003327	Pfam match to entry PF02867 ribonuc_red_lgC, Ribonucleotide reductase, barrel domain , score 598.9, E-value 2e-177
218497003328	PS00185 Isopenicillin N synthetase signature 1.
218497003329	Pfam match to entry PF00317 ribonuc_red_lg, Ribonucleotide reductase, all-alpha domain , score 108.8, E-value 6.7e-30
218497003330	Pfam match to entry PF03477 ATP-cone, ATP cone domain , score 30.8, E-value 2.1e-06
218497003331	Pfam match to entry PF03477 ATP-cone, ATP cone domain , score 91.4, E-value 1.2e-24
218497003332	PS00758 ArgE / dapE / ACY1 / CPG2 / yscS family signature 1.
218497003333	Pfam match to entry PF03477 ATP-cone, ATP cone domain , score 104.9, E-value 1e-28
218497003334	Phosphatidylserine synthase [Lipid metabolism]; Region: PssA; COG1183
218497003335	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; cl00453
218497003336	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; cl00453
218497003337	7 probable transmembrane helices predicted for CAB746 by TMHMM2.0 at aa 15-37, 50-72, 106-128, 148-170, 180-202, 214-235 and 239-261
218497003338	Pfam match to entry PF01066 CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase , score 77.4, E-value 1.9e-20
218497003339	PS00379 CDP-alcohol phosphatidyltransferases signature.
218497003340	RmuC family; Region: RmuC; pfam02646
218497003341	1 probable transmembrane helix predicted for CAB747 by TMHMM2.0 at aa 26-48
218497003342	Pfam match to entry PF02646 DUF195, Uncharacterized BCR, YigN family, COG1322 , score 575.0, E-value 3.1e-170
218497003343	Predicted Zn-dependent peptidases, insulinase-like [General function prediction only]; Region: COG1026
218497003344	Insulinase (Peptidase family M16); Region: Peptidase_M16; pfam00675
218497003345	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
218497003346	Peptidase M16C associated; Region: M16C_assoc; pfam08367
218497003347	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
218497003348	Pfam match to entry PF00675 Peptidase_M16, Insulinase (Peptidase M16) , score -21.2, E-value 0.0035
218497003349	Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism]; Region: ArgE; COG0624
218497003350	Zinc peptidases M18, M20, M28, and M42; Region: Zinc_peptidase_like; cl14876
218497003351	metal binding site [ion binding]; metal-binding site
218497003352	Pfam match to entry PF01546 Peptidase_M20, Peptidase M20/M25/M40 , score 176.4, E-value 2.9e-50
218497003353	periplasmic serine protease, Do/DeqQ family; Region: degP_htrA_DO; TIGR02037
218497003354	Trypsin-like serine protease; Many of these are synthesized as inactive precursor zymogens that are cleaved during limited proteolysis to generate their active forms. Alignment contains also inactive enzymes that have substitutions of the catalytic triad...; Region: Tryp_SPc; cl00149
218497003355	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
218497003356	protein binding site [polypeptide binding]; other site
218497003357	PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis. May be responsible for substrate recognition and/or binding, as most PDZ domains bind...; Region: PDZ_serine_protease; cd00987
218497003358	protein binding site [polypeptide binding]; other site
218497003359	Pfam match to entry PF00595 PDZ, PDZ domain (Also known as DHR or GLGF) , score 18.1, E-value 0.001
218497003360	Pfam match to entry PF00595 PDZ, PDZ domain (Also known as DHR or GLGF) , score 59.3, E-value 5.5e-15
218497003361	Pfam match to entry PF00089 trypsin, Trypsin , score 75.4, E-value 7.6e-20
218497003362	Signal peptide predicted for CAB750 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.967 between residues 27 and 28
218497003363	succinyl-CoA synthetase subunit alpha; Validated; Region: PRK05678
218497003364	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003365	CoA-ligase; Region: Ligase_CoA; pfam00549
218497003366	Pfam match to entry PF00549 ligase-CoA, CoA-ligase , score 205.6, E-value 4.9e-59
218497003367	PS00399 ATP-citrate lyase / succinyl-CoA ligases family active site.
218497003368	PS01216 ATP-citrate lyase / succinyl-CoA ligases family signature 1.
218497003369	Pfam match to entry PF02629 CoA_binding, CoA binding domain , score 184.4, E-value 1.2e-52
218497003370	succinyl-CoA synthetase subunit beta; Provisional; Region: sucC; PRK00696
218497003371	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; cl03087
218497003372	CoA-ligase; Region: Ligase_CoA; pfam00549
218497003373	Pfam match to entry PF00549 ligase-CoA, CoA-ligase , score 151.5, E-value 9.3e-43
218497003374	PS01217 ATP-citrate lyase / succinyl-CoA ligases family signature 3.
218497003375	Pfam match to entry PF02222 ATP-grasp, ATP-grasp domain , score 123.5, E-value 2.6e-34
218497003376	SRP54-type protein, helical bundle domain; Region: SRP54_N; cl03758
218497003377	signal recognition particle-docking protein FtsY; Region: ftsY; TIGR00064
218497003378	The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes. SRP recognizes N-terminal sighnal sequences of newly synthesized polypeptides at the ribosome. The...; Region: SRP; cd03115
218497003379	P loop; other site
218497003380	GTP binding site [chemical binding]; other site
218497003381	Pfam match to entry PF00448 SRP54, SRP54-type protein, GTPase domain , score 329.3, E-value 2.8e-96
218497003382	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003383	Bacterial BAX inhibitor (BI)-1/YccA-like proteins; Region: BI-1-like_bacterial; cd10432
218497003384	Pfam match to entry PF01027 UPF0005, Uncharacterized protein family UPF0005 , score 29.7, E-value 4.4e-06
218497003385	7 probable transmembrane helices predicted for CAB754 by TMHMM2.0 at aa 22-44, 49-67, 82-101, 108-130, 140-162, 169-191 and 206-228
218497003386	Amino acid permease; Region: AA_permease; cl00524
218497003387	11 probable transmembrane helices predicted for CAB755 by TMHMM2.0 at aa 7-29, 39-61, 82-104, 119-138, 151-173, 188-207, 219-241, 275-297, 309-331, 336-355 and 375-393
218497003388	Pfam match to entry PF03222 Trp_Tyr_perm, Tryptophan/tyrosine permease , score 588.8, E-value 2.2e-174
218497003389	glucosamine--fructose-6-phosphate aminotransferase; Reviewed; Region: PRK00331
218497003390	Glutamine amidotransferases class-II (Gn-AT)_GFAT-type. This domain is found at the N-terminus of glucosamine-6P synthase (GlmS, or GFAT in humans).  The glutaminase domain catalyzes amide nitrogen transfer from glutamine to the appropriate substrate. In...; Region: GFAT; cd00714
218497003391	glutaminase active site [active]
218497003392	SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_1; cd05008
218497003393	dimer interface [polypeptide binding]; other site
218497003394	active site
218497003395	SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD). The SIS domain is found in many phosphosugar isomerases and phosphosugar binding proteins. GlmS contains a N-terminal...; Region: SIS_GlmS_GlmD_2; cd05009
218497003396	dimer interface [polypeptide binding]; other site
218497003397	active site
218497003398	Pfam match to entry PF01380 SIS, SIS domain , score 62.2, E-value 7e-16
218497003399	Pfam match to entry PF01380 SIS, SIS domain , score 90.4, E-value 2.3e-24
218497003400	Pfam match to entry PF00310 GATase_2, Glutamine amidotransferases class-II , score 222.1, E-value 5.2e-64
218497003401	PS00443 Glutamine amidotransferases class-II active site.
218497003402	phosphoglucosamine mutase; Provisional; Region: glmM; PRK14314
218497003403	GlmM is a bacterial phosphoglucosamine mutase (PNGM) that belongs to the alpha-D-phosphohexomutase superfamily. It is required for the interconversion of glucosamine-6-phosphate and glucosamine-1-phosphate in the biosynthetic pathway of...; Region: GlmM; cd05802
218497003404	active site
218497003405	substrate binding site [chemical binding]; other site
218497003406	metal binding site [ion binding]; metal-binding site
218497003407	Pfam match to entry PF00408 PGM_PMM, Phosphoglucomutase/phosphomannomutase, C-terminal domain , score 13.1, E-value 0.0013
218497003408	Pfam match to entry PF02880 PGM_PMM_III, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain III , score 88.4, E-value 9.6e-24
218497003409	Pfam match to entry PF02879 PGM_PMM_II, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain II , score 127.7, E-value 1.4e-35
218497003410	Pfam match to entry PF02878 PGM_PMM_I, Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha domain I , score 207.2, E-value 1.7e-59
218497003411	PS00710 Phosphoglucomutase and phosphomannomutase phosphoserine signature.
218497003412	poly(A) polymerase; Region: pcnB; TIGR01942
218497003413	Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398
218497003414	active site
218497003415	NTP binding site [chemical binding]; other site
218497003416	metal binding triad [ion binding]; metal-binding site
218497003417	Probable RNA and SrmB- binding site of polymerase A; Region: PolyA_pol_RNAbd; pfam12627
218497003418	Polymerase A arginine-rich C-terminus; Region: PolyA_pol_arg_C; pfam12626
218497003419	Pfam match to entry PF01743 PolyA_pol, Poly A polymerase , score 222.3, E-value 4.6e-64
218497003420	lipid-A-disaccharide synthase; Reviewed; Region: lpxB; PRK01021
218497003421	Lipid A Biosynthesis N-terminal domain; Region: LAB_N; cl01627
218497003422	Lipid A Biosynthesis N-terminal domain; Region: LAB_N; cl01627
218497003423	Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate...; Region: Glycosyltransferase_GTB_type; cl10013
218497003424	6 probable transmembrane helices predicted for CAB759 by TMHMM2.0 at aa 10-32, 44-61, 65-84, 96-118, 138-157 and 170-192
218497003425	Pfam match to entry PF02684 LpxB, Lipid-A-disaccharide synthetase , score 533.9, E-value 7.4e-158
218497003426	IncA protein; Region: IncA; pfam04156
218497003427	2 probable transmembrane helices predicted for CAB760 by TMHMM2.0 at aa 31-53 and 58-80
218497003428	IncA protein; Region: IncA; pfam04156
218497003429	endonuclease subunit; Provisional; Region: 46; PHA02562
218497003430	2 probable transmembrane helices predicted for CAB761 by TMHMM2.0 at aa 29-51 and 58-80
218497003431	Similar to Chlamydophila caviae hypothetical protein cca00795 SWALL:Q821Z0 (EMBL:AE016997) (243 aa) fasta scores: E(): 1e-41, 56.79% id in 243 aa. CDS contains coiled coil from residues 107-123 and 150-166. This CDS carries a frameshift mutation following codon 208 and premature stop codon; TMH-family membrane protein (pseudogene)
218497003432	2 probable transmembrane helices predicted for CAB763 by TMHMM2.0 at aa 21-38 and 48-70
218497003433	IncA protein; Region: IncA; pfam04156
218497003434	Chromosome segregation ATPases [Cell division and chromosome partitioning]; Region: Smc; COG1196
218497003435	2 probable transmembrane helices predicted for CAB765 by TMHMM2.0 at aa
218497003436	IncA protein; Region: IncA; pfam04156
218497003437	probable transmembrane helices predicted for CAB767 by TMHMM2.0 at aa and 65-87
218497003438	Signal peptide predicted for CAB766 by SignalP 2.0 HMM (Signal peptide probabilty 0.977) with cleavage site probability 0.874 between residues 52 and 53
218497003439	Similar to Chlamydophila caviae hypothetical protein cca00799 SWALL:Q821Y6 (EMBL:AE016997) (872 aa) fasta scores: E(): 7.2e-75, 43.9% id in 870 aa. Note this CDS contains several premature stop codons;conserved TMH-family membrane protein (pseudogene)
218497003440	probable transmembrane helices predicted for CAB770 by TMHMM2.0 ataa 23-80
218497003441	IncA protein; Region: IncA; pfam04156
218497003442	2 probable transmembrane helices predicted for CAB771 by TMHMM2.0 at aa 44-66 and 71-93
218497003443	IncA protein; Region: IncA; pfam04156
218497003444	Chromosome segregation ATPases [Cell division and chromosome partitioning]; Region: Smc; COG1196
218497003445	2 probable transmembrane helices predicted for CAB772 by TMHMM2.0 at aa 30-52 and 57-79
218497003446	Domain of Unknown Function (DUF1539); Region: DUF1539; pfam07560
218497003447	Domain of Unknown Function (DUF1548); Region: DUF1548; pfam07579
218497003448	1 probable transmembrane helix predicted for CAB773 by TMHMM2.0 at aa 58-80
218497003449	Domain of Unknown Function (DUF1539); Region: DUF1539; pfam07560
218497003450	Domain of Unknown Function (DUF1539); Region: DUF1539; pfam07560
218497003451	Domain of Unknown Function (DUF1548); Region: DUF1548; pfam07579
218497003452	1 probable transmembrane helix predicted for CAB774 by TMHMM2.0 at aa 62-84
218497003453	Domain of Unknown Function (DUF1539); Region: DUF1539; pfam07560
218497003454	Domain of Unknown Function (DUF1548); Region: DUF1548; pfam07579
218497003455	1 probable transmembrane helix predicted for CAB775 by TMHMM2.0 at aa 61-83
218497003456	PS00343 Gram-positive cocci surface proteins 'anchoring' hexapeptide.
218497003457	Chlamydial polymorphic outer membrane protein repeat; Region: POMP_repeat; TIGR01376
218497003458	adhesin; Provisional; Region: PRK09752
218497003459	Chlamydia polymorphic membrane protein middle domain; Region: ChlamPMP_M; pfam07548
218497003460	Autotransporter beta-domain; Region: Autotransporter; cl02365
218497003461	Pfam match to entry PF03797 Autotransporter, Autotransporter beta-domain , score 99.5, E-value 4.4e-27
218497003462	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 25.1, E-value 2.3e-07
218497003463	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 16.9, E-value 4.6e-05
218497003464	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 16.4, E-value 6.3e-05
218497003465	Pfam match to entry PF02415 DUF145, Chlamydia protein of unknown function , score 22.3, E-value 1.4e-06
218497003466	PS00290 Immunoglobulins and major histocompatibility complex proteins signature.
218497003467	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003468	Phosphate acetyl/butaryl transferase; Region: PTA_PTB; cl00390
218497003469	Pfam match to entry PF02504 FA_synthesis, Fatty acid synthesis protein , score 504.4, E-value 5.6e-149
218497003470	Ribosomal L32p protein family; Region: Ribosomal_L32p; cl09115
218497003471	Pfam match to entry PF01783 Ribosomal_L32p, Ribosomal L32p protein family , score 76.4, E-value 4e-20
218497003472	ribonuclease, Rne/Rng family; Region: RNaseEG; TIGR00757
218497003473	S1_RNase_E: RNase E and RNase G, S1-like RNA-binding domain. RNase E is an essential endoribonuclease in the processing and degradation of RNA. In addition to its role in mRNA degradation, RNase E has also been implicated in the processing of rRNA, and...; Region: S1_RNase_E; cd04453
218497003474	homodimer interface [polypeptide binding]; other site
218497003475	oligonucleotide binding site [chemical binding]; other site
218497003476	Pfam match to entry PF00575 S1, S1 RNA binding domain , score 18.8, E-value 8.8e-05
218497003477	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT; Region: LPLAT_GPAT; cd07985
218497003478	putative G3P-binding pocket; other site
218497003479	Secreted/periplasmic Zn-dependent peptidases, insulinase-like [Posttranslational modification, protein turnover, chaperones]; Region: Ptr; COG1025
218497003480	Insulinase (Peptidase family M16); Region: Peptidase_M16; pfam00675
218497003481	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
218497003482	Peptidase M16 inactive domain; Region: Peptidase_M16_C; pfam05193
218497003483	Signal peptide predicted for CAB782 by SignalP 2.0 HMM (Signal peptide probabilty 0.984) with cleavage site probability 0.381 between residues 20 and 21
218497003484	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497003485	Pfam match to entry PF00675 Peptidase_M16, Insulinase (Peptidase M16) , score 77.3, E-value 2.1e-20
218497003486	Protein of unknown function (DUF1504); Region: DUF1504; pfam07399
218497003487	11 probable transmembrane helices predicted for CAB783 by TMHMM2.0 at aa 20-39, 68-90, 105-124, 145-167, 187-209, 230-249, 274-305, 318-337, 352-374, 386-408 and 423-445
218497003488	4-diphosphocytidyl-2-C-methyl-D-erythritol kinase; Provisional; Region: PRK00650
218497003489	Pfam match to entry PF00288 GHMP_kinases, GHMP kinases  ATP-binding protein , score 68.6, E-value 8.6e-18
218497003490	PS00477 Alpha-2-macroglobulin family thiolester region signature.
218497003491	50S ribosomal protein L9; Reviewed; Region: rplI; PRK00137
218497003492	Ribosomal protein L9, N-terminal domain; Region: Ribosomal_L9_N; pfam01281
218497003493	Ribosomal protein L9, C-terminal domain; Region: Ribosomal_L9_C; pfam03948
218497003494	Pfam match to entry PF03948 Ribosomal_L9_C, Ribosomal protein L9, C-terminal domain , score 25.3, E-value 7.5e-06
218497003495	Pfam match to entry PF01281 Ribosomal_L9_N, Ribosomal protein L9, N-terminal domain , score 56.5, E-value 3.8e-14
218497003496	Ribosomal protein S18; Region: Ribosomal_S18; cl00373
218497003497	Pfam match to entry PF01084 Ribosomal_S18, Ribosomal protein S18 , score 102.5, E-value 5.4e-28
218497003498	PS00057 Ribosomal protein S18 signature.
218497003499	Ribosomal protein S6; Region: Ribosomal_S6; cl00414
218497003500	Pfam match to entry PF01250 Ribosomal_S6, Ribosomal protein S6 , score 67.3, E-value 2e-17
218497003501	1 probable transmembrane helix predicted for CAB787 by TMHMM2.0 at aa 64-81
218497003502	Peptidyl-tRNA hydrolase (PTH) is a monomeric protein that cleaves the ester bond linking the nascent peptide and tRNA when peptidyl-tRNA is released prematurely from the ribosome. This ensures the recycling of peptidyl-tRNAs into tRNAs produced through...; Region: PTH; cd00462
218497003503	putative active site [active]
218497003504	catalytic residue [active]
218497003505	Pfam match to entry PF01195 Pept_tRNA_hydro, Peptidyl-tRNA hydrolase , score 203.1, E-value 2.9e-58
218497003506	Ribosomal L25/TL5/CTC N-terminal 5S rRNA binding domain; Region: Ribosomal_L25_TL5_CTC; cd00495
218497003507	ribosomal protein L25, Ctc-form; Region: ctc_TL5; TIGR00731
218497003508	5S rRNA interface [nucleotide binding]; other site
218497003509	CTC domain interface [polypeptide binding]; other site
218497003510	L16 interface [polypeptide binding]; other site
218497003511	Pfam match to entry PF01386 Ribosomal_L25p, Ribosomal L25p family , score 40.6, E-value 2.3e-09
218497003512	glycogen synthase; Provisional; Region: glgA; PRK00654
218497003513	This family is most closely related to the GT1 family of glycosyltransferases. Glycogen synthase catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family...; Region: GT1_Glycogen_synthase_DULL1_like; cd03791
218497003514	ADP-binding pocket [chemical binding]; other site
218497003515	homodimer interface [polypeptide binding]; other site
218497003516	Pfam match to entry PF00534 Glycos_transf_1, Glycosyl transferases group 1 , score 13.0, E-value 5.8e-06
218497003517	CDP-alcohol phosphatidyltransferase; Region: CDP-OH_P_transf; cl00453
218497003518	Pfam match to entry PF01066 CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase , score 109.4, E-value 4.4e-30
218497003519	4 probable transmembrane helices predicted for CAB791 by TMHMM2.0 at aa 27-49, 80-102, 132-154 and 161-183
218497003520	PS00379 CDP-alcohol phosphatidyltransferases signature.
218497003521	glycyl-tRNA synthetase; Provisional; Region: PRK14908
218497003522	Class II Glycyl-tRNA synthetase (GlyRS) alpha subunit core catalytic domain. GlyRS functions as a homodimer in eukaryotes, archaea and some bacteria and as a heterotetramer in the remainder of prokaryotes and in arabidopsis. It is responsible for the...; Region: GlyRS_alpha_core; cd00733
218497003523	dimer interface [polypeptide binding]; other site
218497003524	motif 1; other site
218497003525	active site
218497003526	motif 2; other site
218497003527	motif 3; other site
218497003528	Pfam match to entry PF02091 tRNA_synt_2e, Glycyl-tRNA synthetase alpha subunit , score 759.9, E-value 6.7e-226
218497003529	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497003530	Pfam match to entry PF02092 tRNA_synt_2f, Glycyl-tRNA synthetase beta subunit , score 953.4, E-value 3.8e-284
218497003531	Signal peptide predicted for CAB794 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.977 between residues 18 and 19
218497003532	Signal peptide predicted for CAB796 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.998 between residues 25 and 26
218497003533	DNA primase; Validated; Region: dnaG; PRK05667
218497003534	CHC2 zinc finger; Region: zf-CHC2; cl15369
218497003535	DNA primase catalytic core, N-terminal domain; Region: Toprim_N; pfam08275
218497003536	TOPRIM_DnaG_primases: The topoisomerase-primase (TORPIM) nucleotidyl transferase/hydrolase domain found in the active site regions of proteins similar to Escherichia coli DnaG. Primases synthesize RNA primers for the initiation of DNA replication. DnaG...; Region: TOPRIM_DnaG_primases; cd03364
218497003537	active site
218497003538	metal binding site [ion binding]; metal-binding site
218497003539	interdomain interaction site; other site
218497003540	Pfam match to entry PF01751 Toprim, Toprim domain , score 49.7, E-value 4.3e-12
218497003541	Pfam match to entry PF01807 zf-CHC2, CHC2 zinc finger , score 178.6, E-value 6.5e-51
218497003542	DNA mismatch repair protein MutS; Provisional; Region: PRK05399
218497003543	MutS domain I; Region: MutS_I; pfam01624
218497003544	MutS domain II; Region: MutS_II; pfam05188
218497003545	MutS family domain IV; Region: MutS_IV; pfam05190
218497003546	MutS1 homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal...; Region: ABC_MutS1; cd03284
218497003547	Walker A/P-loop; other site
218497003548	ATP binding site [chemical binding]; other site
218497003549	Q-loop/lid; other site
218497003550	ABC transporter signature motif; other site
218497003551	Walker B; other site
218497003552	D-loop; other site
218497003553	H-loop/switch region; other site
218497003554	Pfam match to entry PF01624 MutS_N, MutS family, N-terminal  DNA binding domain , score 661.2, E-value 3.6e-196
218497003555	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003556	Pfam match to entry PF00488 MutS_C, DNA mismatch repair proteins, mutS family , score 434.4, E-value 6.4e-128
218497003557	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003558	PS00486 DNA mismatch repair proteins mutS family signature.
218497003559	excinuclease ABC subunit C; Validated; Region: uvrC; PRK00558
218497003560	Catalytic GIY-YIG domain of nucleotide excision repair endonucleases UvrC, Cho, and similar proteins; Region: GIY-YIG_UvrC_Cho; cd10434
218497003561	GIY-YIG motif/motif A; other site
218497003562	active site
218497003563	catalytic site [active]
218497003564	putative DNA binding site [nucleotide binding]; other site
218497003565	metal binding site [ion binding]; metal-binding site
218497003566	UvrC Helix-hairpin-helix N-terminal; Region: UvrC_HhH_N; pfam08459
218497003567	H3TH domains of structure-specific 5' nucleases (or flap endonuclease-1-like) involved in DNA replication, repair, and recombination; Region: H3TH_StructSpec-5'-nucleases; cl14815
218497003568	Pfam match to entry PF01541 Exci_endo_N, Endo/excinuclease amino terminal domain , score 125.7, E-value 5.5e-35
218497003569	Protein of unknown function (DUF322); Region: DUF322; cl00574
218497003570	Pfam match to entry PF03780 DUF322, Protein of unknown function (DUF322) , score 146.8, E-value 2.5e-41
218497003571	2 probable transmembrane helices predicted for CAB801 by TMHMM2.0 at aa 4-22 and 29-48
218497003572	Ribosomal protein S14p/S29e; Region: Ribosomal_S14; cl00355
218497003573	Pfam match to entry PF00253 Ribosomal_S14, Ribosomal protein S14p/S29e , score 138.6, E-value 7.1e-39
218497003574	PS00527 Ribosomal protein S14 signature.
218497003575	Ribosomal protein L36; Region: Ribosomal_L36; cl00380
218497003576	Pfam match to entry PF00444 Ribosomal_L36, Ribosomal protein L36 , score 21.4, E-value 5.5e-07
218497003577	Ribonuclease P; Region: Ribonuclease_P; cl00457
218497003578	Pfam match to entry PF00825 Ribonuclease_P, Ribonuclease P , score 51.7, E-value 1e-12
218497003579	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
218497003580	cysteinyl-tRNA synthetase; Validated; Region: cysS; PRK00260
218497003581	catalytic core domain of cysteinyl tRNA synthetase; Region: CysRS_core; cd00672
218497003582	active site
218497003583	HIGH motif; other site
218497003584	catalytic core domain of cysteinyl tRNA synthetase; Region: CysRS_core; cd00672
218497003585	KMSKS motif; other site
218497003586	Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains; Region: Anticodon_Ia_like; cl12020
218497003587	Pfam match to entry PF01406 tRNA-synt_1e, tRNA synthetases class I (C) , score 498.8, E-value 2.7e-147
218497003588	lysyl-tRNA synthetase; Reviewed; Region: lysS; PRK00484
218497003589	LysRS_N: N-terminal, anticodon recognition domain of lysyl-tRNA synthetases (LysRS). These enzymes are homodimeric class 2b aminoacyl-tRNA synthetases (aaRSs). This domain is a beta-barrel domain (OB fold) involved in binding the tRNA anticodon stem-loop; Region: LysRS_N; cd04322
218497003590	dimer interface [polypeptide binding]; other site
218497003591	putative anticodon binding site; other site
218497003592	Class II tRNA amino-acyl synthetase-like catalytic core domain. Class II amino acyl-tRNA synthetases (aaRS) share a common fold and generally attach an amino acid to the 3' OH of ribose of the appropriate tRNA.   PheRS is an exception in that it attaches...; Region: class_II_aaRS-like_core; cl00268
218497003593	motif 1; other site
218497003594	dimer interface [polypeptide binding]; other site
218497003595	active site
218497003596	motif 2; other site
218497003597	motif 3; other site
218497003598	Pfam match to entry PF00152 tRNA-synt_2, tRNA synthetases class II (D, K and N) , score 396.3, E-value 2e-116
218497003599	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497003600	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
218497003601	Pfam match to entry PF01336 tRNA_anti, OB-fold nucleic acid binding domain , score 56.9, E-value 2.9e-14
218497003602	Protein Disulfide Oxidoreductases and Other Proteins with a Thioredoxin fold; Region: Thioredoxin_like; cl00388
218497003603	Signal peptide predicted for CAB808 by SignalP 2.0 HMM (Signal peptide probabilty 0.977) with cleavage site probability 0.785 between residues 24 and 25
218497003604	primosome assembly protein PriA; Validated; Region: PRK05580
218497003605	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
218497003606	ATP binding site [chemical binding]; other site
218497003607	putative Mg++ binding site [ion binding]; other site
218497003608	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497003609	Predicted helix-turn-helix motif with score 1236.000, SD 3.40 at aa 160-181, sequence PGLSELMDKAKVSQSPIHSLEK
218497003610	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003611	Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain , score 24.8, E-value 0.00011
218497003612	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
218497003613	Aminotransferase class I and II; Region: Aminotran_1_2; pfam00155
218497003614	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
218497003615	catalytic residue [active]
218497003616	Pfam match to entry PF00155 aminotran_1_2, Aminotransferase class I and II , score 31.6, E-value 2e-08
218497003617	PS00867 Carbamoyl-phosphate synthase subdomain signature 2.
218497003618	PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site.
218497003619	Acetyl-CoA Synthetase and similar proteins; Region: Acetyl-CoA_Synthetase; cl15355
218497003620	Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]; Region: CaiC; COG0318
218497003621	Pfam match to entry PF00501 AMP-binding, AMP-binding enzyme , score 255.4, E-value 5e-74
218497003622	Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like; Region: LPLAT_AGPAT-like; cd07989
218497003623	putative acyl-acceptor binding pocket; other site
218497003624	Pfam match to entry PF01553 Acyltransferase, Acyltransferase , score 27.1, E-value 6.5e-08
218497003625	PAP-phosphatase_like domains. PAP-phosphatase is a member of the inositol monophosphatase family, and catalyses the hydrolysis of 3'-phosphoadenosine-5'-phosphate (PAP) to AMP. In Saccharomyces cerevisiae, HAL2 (MET22) is involved in methionine...; Region: PAP_phosphatase; cd01517
218497003626	active site
218497003627	putative lithium-binding site [ion binding]; other site
218497003628	substrate binding site [chemical binding]; other site
218497003629	Pfam match to entry PF00459 inositol_P, Inositol monophosphatase , score 173.4, E-value 2.4e-49
218497003630	PS00629 Inositol monophosphatase signature 1.
218497003631	Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism]; Region: GdhA; COG0334
218497003632	Glu/Leu/Phe/Val dehydrogenase, dimerisation domain; Region: ELFV_dehydrog_N; pfam02812
218497003633	NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase; Region: NAD_bind_Leu_Phe_Val_DH; cd01075
218497003634	NAD binding site [chemical binding]; other site
218497003635	Phe binding site; other site
218497003636	Pfam match to entry PF00208 GLFV_dehydrog, Glutamate/Leucine/Phenylalanine/Valine dehydrogenase , score 129.0, E-value 5.8e-36
218497003637	Pfam match to entry PF02812 GLFV_dehydrog_N, Glu/Leu/Phe/Val dehydrogenase, dimerisation domain , score 70.4, E-value 2.5e-18
218497003638	Inorganic pyrophosphatase. These enzymes hydrolyze inorganic pyrophosphate (PPi) to two molecules of orthophosphates (Pi). The reaction requires bivalent cations. The enzymes in general exist as homooligomers; Region: pyrophosphatase; cd00412
218497003639	dimer interface [polypeptide binding]; other site
218497003640	substrate binding site [chemical binding]; other site
218497003641	metal binding sites [ion binding]; metal-binding site
218497003642	Pfam match to entry PF00719 Pyrophosphatase, Inorganic pyrophosphatase , score 82.8, E-value 4.4e-22
218497003643	PS00387 Inorganic pyrophosphatase signature.
218497003644	Diadenosine tetraphosphate (Ap4A) hydrolase is a member of the Nudix hydrolase superfamily. Ap4A hydrolases are well represented in a variety of prokaryotic and eukaryotic organisms. Phylogenetic analysis reveals two distinct subgroups where plant...; Region: Ap4A_hydrolase_human_like; cd03428
218497003645	active site
218497003646	Ap4A binding cleft/pocket [chemical binding]; other site
218497003647	P4 phosphate binding site; other site
218497003648	nudix motif; other site
218497003649	putative P2/P3 phosphate binding site [ion binding]; other site
218497003650	Pfam match to entry PF00293 NUDIX, NUDIX domain , score 75.8, E-value 5.8e-20
218497003651	PS00893 mutT domain signature.
218497003652	3-oxoacyl-(acyl carrier protein) synthase II; Reviewed; Region: PRK06333
218497003653	Beta-ketoacyl-acyl carrier protein (ACP) synthase (KAS), type I and II. KASs are responsible for the elongation steps in fatty acid biosynthesis. KASIII catalyses the initial condensation and KAS I and II catalyze further elongation steps by Claisen...; Region: KAS_I_II; cd00834
218497003654	dimer interface [polypeptide binding]; other site
218497003655	active site
218497003656	Pfam match to entry PF02801 ketoacyl-synt_C, Beta-ketoacyl synthase, C-terminal domain , score 234.0, E-value 1.4e-67
218497003657	Pfam match to entry PF00109 ketoacyl-synt, Beta-ketoacyl synthase, N-terminal domain , score 287.0, E-value 1.6e-83
218497003658	PS00606 Beta-ketoacyl synthases active site.
218497003659	PS00205 Transferrins signature 1.
218497003660	Domain of unknown function DUF143; Region: DUF143; cl00519
218497003661	Pfam match to entry PF02410 DUF143, Domain of unknown function DUF143 , score 176.0, E-value 4.1e-50
218497003662	Similar to Chlamydophila caviae hypothetical protein CCA00855 SWALL:Q821T1 (EMBL:AE016997) (213 aa) fasta scores: E(): 3.8e-53, 80.81% id in 172 aa, and to Chlamydia pneumoniae hypothetical protein CPN0914 SWALL:Q9Z6Z2 (EMBL:AE001671) (133 aa) fasta scores: E(): 1.7e-31, 65.9% id in 132 aa. Note this CDS has a frame shift mutation within a 10x'T' homopolymeric tract. This may indicate that the expression of the product of this CDS is subject to phase variation. Only significant full-length database matches are to Chlamydiaceae proteins.;conserved hypothetical protein (pseudogene)
218497003663	homopolymeric tract of 10xT residues. This is also the site of a frame shift in CAB820 which suggests that the protein product of this CDS is sunbject to phase variation
218497003664	chromosome segregation protein SMC, common bacterial type; Region: SMC_prok_B; TIGR02168
218497003665	hypothetical protein; Provisional; Region: PRK05927
218497003666	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497003667	FeS/SAM binding site; other site
218497003668	IPP transferase; Region: IPPT; cl00403
218497003669	tRNA delta(2)-isopentenylpyrophosphate transferase [Translation, ribosomal structure and biogenesis]; Region: MiaA; COG0324
218497003670	Pfam match to entry PF01715 IPPT, IPP transferase , score 227.7, E-value 1.1e-65
218497003671	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003672	Sulphate Transporter and Anti-Sigma factor antagonist) domain of anti-anti-sigma factors, key regulators of anti-sigma factors by phosphorylation; Region: STAS_anti-anti-sigma_factors; cd07043
218497003673	anti sigma factor interaction site; other site
218497003674	regulatory phosphorylation site [posttranslational modification]; other site
218497003675	Pfam match to entry PF01740 STAS, STAS domain , score 79.8, E-value 3.8e-21
218497003676	CutA1 divalent ion tolerance protein; Region: CutA1; cl00584
218497003677	Pfam match to entry PF03091 CutA1, CutA1 divalent ion tolerance protein , score 156.1, E-value 4.1e-44
218497003678	Predicted RNA-binding protein (contains KH domain) [General function prediction only]; Region: COG1837; cl00794
218497003679	Pfam match to entry PF00013 KH, KH domain , score 12.5, E-value 0.0091
218497003680	bifunctional D-alanyl-alanine synthetase A/UDP-N-acetylmuramate--L-alanine ligase; Provisional; Region: PRK14573
218497003681	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
218497003682	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
218497003683	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
218497003684	D-ala D-ala ligase N-terminus; Region: Dala_Dala_lig_N; pfam01820
218497003685	Carbamoyl-phosphate synthase L chain, ATP binding domain; Region: CPSase_L_D2; cl03087
218497003686	Pfam match to entry PF01820 Dala_Dala_ligas, D-ala D-ala ligase , score 397.2, E-value 1.1e-116
218497003687	PS00843 D-alanine--D-alanine ligase signature 1.
218497003688	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003689	Pfam match to entry PF02875 Mur_ligase_C, Mur ligase, glutamate ligase domain , score 85.1, E-value 9.1e-23
218497003690	Pfam match to entry PF01225 Mur_ligase, Mur ligase, catalytic domain , score 152.0, E-value 6.6e-43
218497003691	1 probable transmembrane helix predicted for CAB829 by TMHMM2.0 at aa 5-24
218497003692	undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Region: murG; TIGR01133
218497003693	MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis. It transfers N-acetyl-D-glucosamine (GlcNAc) from UDP-GlcNAc to the C4 hydroxyl of a lipid-linked N-acetylmuramoyl pentapeptide...; Region: GT1_MurG; cd03785
218497003694	active site
218497003695	homodimer interface [polypeptide binding]; other site
218497003696	Pfam match to entry PF03033 Glyco_transf_28, Glycosyltransferase 28 N-terminal domain , score 320.5, E-value 1.3e-93
218497003697	Cell cycle protein; Region: FTSW_RODA_SPOVE; cl00511
218497003698	Pfam match to entry PF01098 FTSW_RODA_SPOVE, Cell cycle protein , score 260.6, E-value 1.3e-75
218497003699	8 probable transmembrane helices predicted for CAB831 by TMHMM2.0 at aa 41-63, 73-92, 137-154, 159-176, 181-203, 267-289, 301-323 and 333-355
218497003700	Signal peptide predicted for CAB831 by SignalP 2.0 HMM (Signal peptide probabilty 0.982) with cleavage site probability 0.545 between residues 25 and 26
218497003701	Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function; Region: LysM; cd00118
218497003702	putative peptidoglycan binding site; other site
218497003703	Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function; Region: LysM; cd00118
218497003704	putative peptidoglycan binding site; other site
218497003705	Pfam match to entry PF01476 LysM, LysM domain , score 48.5, E-value 9.8e-12
218497003706	Pfam match to entry PF01476 LysM, LysM domain , score 61.6, E-value 1.1e-15
218497003707	Signal peptide predicted for CAB832 by SignalP 2.0 HMM (Signal peptide probabilty 0.832) with cleavage site probability 0.780 between residues 28 and 29
218497003708	UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional; Region: murD; PRK00683
218497003709	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cl12011
218497003710	S-adenosylmethionine binding site [chemical binding]; other site
218497003711	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497003712	Walker A/P-loop; other site
218497003713	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
218497003714	ATP binding site [chemical binding]; other site
218497003715	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
218497003716	Pfam match to entry PF02875 Mur_ligase_C, Mur ligase, glutamate ligase domain , score 47.5, E-value 2e-11
218497003717	Pfam match to entry PF01225 Mur_ligase, Mur ligase, catalytic domain , score 52.3, E-value 2e-15
218497003718	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003719	phospho-N-acetylmuramoyl-pentapeptide-transferase; Provisional; Region: mraY; PRK00108
218497003720	Phospho-N-acetylmuramoyl-pentapeptide-transferase (mraY) is an enzyme responsible for the formation of the first lipid intermediate in the synthesis of bacterial cell wall peptidoglycan. It catalyzes the formation of...; Region: GT_MraY; cd06852
218497003721	Mg++ binding site [ion binding]; other site
218497003722	putative catalytic motif [active]
218497003723	putative substrate binding site [chemical binding]; other site
218497003724	9 probable transmembrane helices predicted for CAB834 by TMHMM2.0 at aa 10-29, 67-86, 90-107, 127-149, 169-191, 198-220, 248-270, 275-297 and 329-346
218497003725	Pfam match to entry PF00953 Glycos_transf_4, Glycosyl transferase , score 153.2, E-value 3e-43
218497003726	Mur ligase family, catalytic domain; Region: Mur_ligase; pfam01225
218497003727	UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Region: murF; TIGR01143
218497003728	Mur ligase middle domain; Region: Mur_ligase_M; pfam08245
218497003729	Mur ligase family, glutamate ligase domain; Region: Mur_ligase_C; pfam02875
218497003730	Pfam match to entry PF02875 Mur_ligase_C, Mur ligase, glutamate ligase domain , score 28.9, E-value 7.9e-06
218497003731	Pfam match to entry PF01225 Mur_ligase, Mur ligase, catalytic domain , score 64.0, E-value 2.1e-16
218497003732	chaperonin_like superfamily. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. There are 2 main chaperonin groups. The symmetry of type I...; Region: chaperonin_like; cl02777
218497003733	TCP-1/cpn60 chaperonin family; Region: Cpn60_TCP1; pfam00118
218497003734	Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family , score 162.2, E-value 5.9e-46
218497003735	Calcineurin-like phosphoesterase; Region: Metallophos; pfam00149
218497003736	metallophosphatase superfamily, metallophosphatase domain; Region: MPP_superfamily; cl13995
218497003737	active site
218497003738	metal binding site [ion binding]; metal-binding site
218497003739	Pfam match to entry PF00149 Metallophos, Calcineurin-like phosphoesterase , score 63.6, E-value 2.8e-16
218497003740	elongation factor P; Validated; Region: PRK00529
218497003741	Elongation factor P (EF-P) KOW-like domain; Region: EFP_N; pfam08207
218497003742	S1_EF-P_repeat_1: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_1; cd04470
218497003743	RNA binding site [nucleotide binding]; other site
218497003744	S1_EF-P_repeat_2: Translation elongation factor P (EF-P), S1-like RNA-binding domain, repeat 1. EF-P stimulates the peptidyltransferase activity in the prokaryotic 70S ribosome. EF-P enhances the synthesis of certain dipeptides with...; Region: S1_EF-P_repeat_2; cd05794
218497003745	RNA binding site [nucleotide binding]; other site
218497003746	Pfam match to entry PF01132 EFP, Elongation factor P (EF-P) , score 258.9, E-value 4.4e-75
218497003747	Phosphorylase superfamily; Region: PNP_UDP_1; cl00303
218497003748	Pfam match to entry PF01048 PNP_UDP_1, Phosphorylase , score -27.4, E-value 2.2e-05
218497003749	transketolase; Reviewed; Region: PRK05899
218497003750	Thiamine pyrophosphate (TPP) family, Transketolase (TK) subfamily, TPP-binding module; TK catalyzes the transfer of a two-carbon unit from ketose phosphates to aldose phosphates. In heterotrophic organisms, TK provides a link between glycolysis and the...; Region: TPP_TK; cd02012
218497003751	TPP-binding site [chemical binding]; other site
218497003752	dimer interface [polypeptide binding]; other site
218497003753	Pyrimidine (PYR) binding domain of 1-deoxy-D-xylulose-5-phosphate synthase (DXS), transketolase (TK), and related proteins; Region: TPP_PYR_DXS_TK_like; cd07033
218497003754	PYR/PP interface [polypeptide binding]; other site
218497003755	dimer interface [polypeptide binding]; other site
218497003756	TPP binding site [chemical binding]; other site
218497003757	Transketolase, C-terminal domain; Region: Transketolase_C; pfam02780
218497003758	Pfam match to entry PF02780 transketolase_C, Transketolase, C-terminal domain , score 13.5, E-value 5.7e-05
218497003759	Pfam match to entry PF02779 transket_pyr, Transketolase, pyridine binding domain , score 214.0, E-value 1.5e-61
218497003760	PS00213 Lipocalin signature.
218497003761	Pfam match to entry PF00456 transketolase, Transketolase, thiamine diphosphate binding domain , score 507.2, E-value 8e-150
218497003762	alanyl-tRNA synthetase; Reviewed; Region: alaS; PRK00252
218497003763	Alanyl-tRNA synthetase (AlaRS) class II core catalytic domain. AlaRS is a homodimer. It is responsible for the attachment of alanine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent formation of...; Region: AlaRS_core; cd00673
218497003764	motif 1; other site
218497003765	active site
218497003766	motif 2; other site
218497003767	motif 3; other site
218497003768	Threonyl and Alanyl tRNA synthetase second additional domain; Region: tRNA_SAD; cl08469
218497003769	DHHA1 domain; Region: DHHA1; pfam02272
218497003770	Pfam match to entry PF01411 tRNA-synt_2c, tRNA synthetases class II (A) , score 1326.8, E-value 0
218497003771	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497003772	Pfam match to entry PF02272 DHHA1, DHHA1 domain , score 43.0, E-value 4.3e-10
218497003773	Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription]; Region: Mfd; COG1197
218497003774	CarD-like/TRCF domain; Region: CarD_TRCF; cl00588
218497003775	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
218497003776	ATP binding site [chemical binding]; other site
218497003777	putative Mg++ binding site [ion binding]; other site
218497003778	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
218497003779	nucleotide binding region [chemical binding]; other site
218497003780	ATP-binding site [chemical binding]; other site
218497003781	TRCF domain; Region: TRCF; cl04088
218497003782	Pfam match to entry PF00270 DEAD, DEAD/DEAH box helicase , score 123.1, E-value 3.3e-34
218497003783	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003784	Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain , score 74.0, E-value 2e-19
218497003785	Pfam match to entry PF03461 TRCF, TRCF domain , score 138.0, E-value 1.1e-38
218497003786	Uroporphyrinogen decarboxylase (URO-D) is a dimeric cytosolic enzyme that decarboxylates the four acetate side chains of uroporphyrinogen III (uro-III) to create coproporphyrinogen III, without requiring any prosthetic groups or cofactors. This reaction...; Region: URO-D; cd00717
218497003787	substrate binding site [chemical binding]; other site
218497003788	active site
218497003789	Pfam match to entry PF01208 URO-D, Uroporphyrinogen decarboxylase (URO-D) , score 161.4, E-value 9.9e-46
218497003790	coproporphyrinogen III oxidase; Provisional; Region: PRK09249
218497003791	HemN C-terminal region; Region: HemN_C; pfam06969
218497003792	Pfam match to entry PF02473 Coprogen_an_ox, Oxygen-independent Coproporphyrinogen III oxidase , score 487.8, E-value 5.6e-144
218497003793	Protoporphyrinogen oxidase [Coenzyme metabolism]; Region: HemY; COG1232
218497003794	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003795	Pfam match to entry PF01593 Amino_oxidase, Flavin containing amine oxidoreductase , score 24.9, E-value 7.2e-08
218497003796	Predicted helix-turn-helix motif with score 988.000, SD 2.55 at aa 386-407, sequence VSILDHASRLGVTLPRVYEYLG
218497003797	Histone H1-like protein Hc1; Region: Hc1; pfam07432
218497003798	SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis]; Region: TrmA; COG2265
218497003799	S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases; cd02440
218497003800	S-adenosylmethionine binding site [chemical binding]; other site
218497003801	PS01231 RNA methyltransferase trmA family signature 2.
218497003802	Preprotein translocase subunit; Region: YajC; cl00806
218497003803	Pfam match to entry PF02699 DUF219, Uncharacterized secreted proteins, YajC family COG1862 , score 141.6, E-value 9e-40
218497003804	1 probable transmembrane helix predicted for CAB850 by TMHMM2.0 at aa 25-44
218497003805	Na(+)-translocating NADH-quinone reductase subunit F; Provisional; Region: PRK05464
218497003806	2Fe-2S iron-sulfur cluster binding domain. Iron-sulfur proteins play an important role in electron transfer processes and in various enzymatic reactions. The family includes plant and algal ferredoxins, which act as electron carriers in photosynthesis...; Region: fer2; cd00207
218497003807	catalytic loop [active]
218497003808	iron binding site [ion binding]; other site
218497003809	Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase; Region: NADH_quinone_reductase; cd06188
218497003810	FAD binding pocket [chemical binding]; other site
218497003811	FAD binding motif [chemical binding]; other site
218497003812	phosphate binding motif [ion binding]; other site
218497003813	beta-alpha-beta structure motif; other site
218497003814	NAD binding pocket [chemical binding]; other site
218497003815	1 probable transmembrane helix predicted for CAB851 by TMHMM2.0 at aa 7-29
218497003816	Pfam match to entry PF00111 fer2, 2Fe-2S iron-sulfur cluster binding domain , score 51.9, E-value 9.5e-13
218497003817	Pfam match to entry PF00175 NAD_binding_1, Oxidoreductase NAD-binding domain , score 22.9, E-value 7.8e-07
218497003818	Protein of unknown function (DUF687); Region: DUF687; pfam05095
218497003819	3 probable transmembrane helices predicted for CAB852 by TMHMM2.0 at aa 259-281, 398-420 and 456-478
218497003820	DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning]; Region: FtsK; COG1674
218497003821	DNA segregation ATPase FtsK/SpoIIIE and related proteins [Cell division and chromosome partitioning]; Region: FtsK; COG1674
218497003822	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497003823	Ftsk gamma domain; Region: Ftsk_gamma; cl09645
218497003824	Signal peptide predicted for CAB855 by SignalP 2.0 HMM (Signal peptide probabilty 0.750) with cleavage site probability 0.592 between residues 27 and 28
218497003825	5 probable transmembrane helices predicted for CAB855 by TMHMM2.0 at aa 21-43, 63-85, 98-120, 133-155 and 168-190
218497003826	Pfam match to entry PF01580 FtsK_SpoIIIE, FtsK/SpoIIIE family , score 216.3, E-value 2.9e-62
218497003827	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003828	Metallo-beta-lactamase superfamily; Region: Lactamase_B; cl00446
218497003829	Pfam match to entry PF00753 lactamase_B, Metallo-beta-lactamase superfamily , score 28.6, E-value 1.5e-08
218497003830	SET domain; Region: SET; cl02566
218497003831	Pfam match to entry PF00856 SET, SET domain , score 147.2, E-value 1.8e-41
218497003832	PhosphatidylEthanolamine-Binding Protein (PEBP) domain present in bacteria and archaea; Region: PEBP_bact_arch; cd00865
218497003833	substrate binding site [chemical binding]; other site
218497003834	Sodium:alanine symporter family; Region: Na_Ala_symp; cl00548
218497003835	Pfam match to entry PF01235 Na_Ala_symp, Sodium:alanine symporter family , score 99.9, E-value 3.2e-27
218497003836	11 probable transmembrane helices predicted for CAB859 by TMHMM2.0 at aa 10-32, 67-89, 94-116, 146-168, 183-200, 207-229, 233-255, 300-322, 342-364, 385-407 and 412-429
218497003837	Signal peptide predicted for CAB860 by SignalP 2.0 HMM (Signal peptide probabilty 0.973) with cleavage site probability 0.607 between residues 28 and 29
218497003838	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497003839	Signal peptide predicted for CAB861 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.496 between residues 24 and 25
218497003840	lumazine synthase (6,7-dimethyl-8-ribityllumazine synthase, LS), catalyzes the penultimate step in the biosynthesis of riboflavin (vitamin B2); type-I; Region: Lumazine_synthase-I; cd09209
218497003841	homopentamer interface [polypeptide binding]; other site
218497003842	active site
218497003843	Pfam match to entry PF00885 DMRL_synthase, 6,7-dimethyl-8-ribityllumazine synthase , score 138.9, E-value 5.7e-39
218497003844	bifunctional 3,4-dihydroxy-2-butanone 4-phosphate synthase/GTP cyclohydrolase II protein; Provisional; Region: PRK09311
218497003845	3,4-dihydroxy-2-butanone 4-phosphate synthase; Region: DHBP_synthase; cl00336
218497003846	GTP cyclohydrolase II (RibA).  GTP cyclohydrolase II catalyzes the conversion of GTP to 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5' phosphate, formate, pyrophosphate (APy), and GMP in the biosynthetic pathway of riboflavin. Riboflavin is the...; Region: GTP_cyclohydro2; cd00641
218497003847	dimerization interface [polypeptide binding]; other site
218497003848	active site
218497003849	Pfam match to entry PF00925 GTP_cyclohydro2, GTP cyclohydrolase II , score 349.4, E-value 2.6e-102
218497003850	Pfam match to entry PF00926 DHBP_synthase, 3,4-dihydroxy-2-butanone 4-phosphate synthase , score 340.9, E-value 9.5e-100
218497003851	PS00430 TonB-dependent receptor proteins signature 1.
218497003852	riboflavin biosynthesis protein RibD; Region: eubact_ribD; TIGR00326
218497003853	Riboflavin-specific deaminase. Riboflavin biosynthesis protein RibD (Diaminohydroxyphosphoribosylaminopyrimidine deaminase) catalyzes the deamination of 2,5-diamino-6-ribosylamino-4(3H)-pyrimidinone 5'-phosphate, which is an intermediate step in the...; Region: Riboflavin_deaminase-reductase; cd01284
218497003854	catalytic motif [active]
218497003855	Zn binding site [ion binding]; other site
218497003856	Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5; Region: DHFR; cl00161
218497003857	Pfam match to entry PF01872 RibD_C, RibD C-terminal domain , score 222.9, E-value 3e-64
218497003858	Pfam match to entry PF00383 dCMP_cyt_deam, Cytidine and deoxycytidylate deaminase zinc-binding region , score 133.1, E-value 3.2e-37
218497003859	PS00903 Cytidine and deoxycytidylate deaminases zinc-binding region signature.
218497003860	seryl-tRNA synthetase; Provisional; Region: PRK05431
218497003861	Seryl-tRNA synthetase N-terminal domain; Region: Seryl_tRNA_N; pfam02403
218497003862	Seryl-tRNA synthetase (SerRS) class II core catalytic domain. SerRS is responsible for the attachment of serine to the 3' OH group of ribose of the appropriate tRNA. This domain It is primarily responsible for ATP-dependent formation of the enzyme bound...; Region: SerRS_core; cd00770
218497003863	dimer interface [polypeptide binding]; other site
218497003864	active site
218497003865	motif 1; other site
218497003866	motif 2; other site
218497003867	motif 3; other site
218497003868	Pfam match to entry PF02403 Seryl_tRNA_N, Seryl-tRNA synthetase N-terminal domain , score 52.4, E-value 6.3e-13
218497003869	Pfam match to entry PF00587 tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) , score 196.5, E-value 2.6e-56
218497003870	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
218497003871	CCC1-related protein family; Region: CCC1_like_1; cd02437
218497003872	4 probable transmembrane helices predicted for CAB866 by TMHMM2.0 at aa 37-59, 69-88, 185-207 and 222-244
218497003873	heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase; Region: ATPase-IB2_Cd; TIGR01512
218497003874	E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122
218497003875	Haloacid Dehalogenase-like Hydrolases; Region: HAD_like; cl11391
218497003876	7 probable transmembrane helices predicted for CAB867 by TMHMM2.0 at aa 41-63, 68-86, 106-128, 267-289, 304-326, 608-627 and 631-653
218497003877	Pfam match to entry PF00122 E1-E2_ATPase, E1-E2 ATPase , score 184.3, E-value 1.3e-52
218497003878	Pfam match to entry PF00702 Hydrolase, haloacid dehalogenase-like hydrolase , score 102.5, E-value 5.2e-28
218497003879	PS00154 E1-E2 ATPases phosphorylation site.
218497003880	PS01229 Hypothetical cof family signature 2.
218497003881	Cell cycle protein; Region: FTSW_RODA_SPOVE; cl00511
218497003882	Pfam match to entry PF01098 FTSW_RODA_SPOVE, Cell cycle protein , score 176.4, E-value 3.1e-50
218497003883	10 probable transmembrane helices predicted for CAB868 by TMHMM2.0 at aa 7-29, 51-70, 77-99, 109-131, 144-161, 166-185, 192-214, 287-309, 314-336 and 346-368
218497003884	PS00012 Phosphopantetheine attachment site.
218497003885	PS00428 Cell cycle proteins ftsW / rodA / spoVE signature.
218497003886	Biotin/lipoate A/B protein ligase family; Region: BPL_LplA_LipB; cl14057
218497003887	Pfam match to entry PF03099 BPL_LipA_LipB, Biotin/lipoate A/B protein ligase , score 57.4, E-value 2.1e-14
218497003888	1 probable transmembrane helix predicted for CAB870 by TMHMM2.0 at aa 5-27
218497003889	16S rRNA uridine-516 pseudouridylate synthase and related pseudouridylate synthases [Translation, ribosomal structure and biogenesis]; Region: RsuA; COG1187
218497003890	S4/Hsp/ tRNA synthetase RNA-binding domain; The domain surface is populated by conserved, charged residues that define a likely RNA-binding site;  Found in stress proteins, ribosomal proteins and tRNA synthetases; This may imply a hitherto unrecognized...; Region: S4; cd00165
218497003891	RNA binding surface [nucleotide binding]; other site
218497003892	PseudoU_synth_RsuA: Pseudouridine synthase, Escherichia coli RsuA like. This group is comprised of eukaryotic and bacterial proteins similar to Escherichia coli RsuA. Pseudouridine synthases catalyze the isomerization of specific uridines in an RNA...; Region: PseudoU_synth_RsuA; cd02553
218497003893	active site
218497003894	uracil binding [chemical binding]; other site
218497003895	Pfam match to entry PF00849 PseudoU_synth_2, RNA pseudouridylate synthase , score 96.3, E-value 4e-26
218497003896	PS01149 Rsu family of pseudouridine synthase signature.
218497003897	Pfam match to entry PF01479 S4, S4 domain , score 39.6, E-value 4.7e-09
218497003898	Histidine phosphatase domain found in phosphoglycerate mutases and related proteins, mostly phosphatases; contains a His residue which is phosphorylated during the reaction; Region: HP_PGM_like; cd07067
218497003899	catalytic core [active]
218497003900	Pfam match to entry PF00300 PGAM, Phosphoglycerate mutase , score 199.8, E-value 2.8e-57
218497003901	Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones]; Region: csdA; COG0520
218497003902	Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes. PLP combines with an alpha-amino acid to form a compound called a Schiff base or aldimine intermediate, which depending on the reaction, is the...; Region: AAT_I; cl00321
218497003903	pyridoxal 5'-phosphate binding pocket [chemical binding]; other site
218497003904	catalytic residue [active]
218497003905	Iron-sulfur cluster scaffold-like proteins; Region: IscU_like; cl00528
218497003906	NifU-like domain; Region: NifU; cl00484
218497003907	Pfam match to entry PF01592 NifU_N, NifU-like N terminal domain , score -11.9, E-value 5.9e-05
218497003908	Pfam match to entry PF01106 NifU-like, NifU-like domain , score 9.6, E-value 3.4e-05
218497003909	type III secretion system protein; Validated; Region: PRK05934
218497003910	Secretory protein of YscJ/FliF family; Region: YscJ_FliF; cl01907
218497003911	MgtE intracellular N domain; Region: MgtE_N; cl15244
218497003912	Signal peptide predicted for CAB875 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.684 between residues 28 and 29
218497003913	probable transmembrane helices predicted for CAB875 by TMHMM2.0 at aa 250-272
218497003914	flagellar assembly protein H; Validated; Region: fliH; PRK06669
218497003915	type III secretion system ATPase; Validated; Region: PRK05922
218497003916	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497003917	Walker A motif; other site
218497003918	ATP binding site [chemical binding]; other site
218497003919	Walker B motif; other site
218497003920	Pfam match to entry PF02874 ATP-synt_ab_N, ATP synthase alpha/beta family, beta-barrel domain , score 23.6, E-value 0.00031
218497003921	Pfam match to entry PF00006 ATP-synt_ab, ATP synthase alpha/beta family, nucleotide-binding domain , score 359.2, E-value 2.8e-105
218497003922	PS00152 ATP synthase alpha and beta subunits signature.
218497003923	UDP-glucose pyrophosphorylase [Carbohydrate transport and metabolism]; Region: COG4284
218497003924	UDPGlcNAc pyrophosphorylase catalayzes the synthesis of UDPGlcNAc; Region: UDPGlcNAc_PPase; cd04193
218497003925	substrate binding site; other site
218497003926	dimerization interface; other site
218497003927	Pfam match to entry PF01704 UDPGP, UTP--glucose-1-phosphate uridylyltransferase , score 336.4, E-value 2.1e-98
218497003928	NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated; Region: gpsA; PRK00094
218497003929	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497003930	NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus; Region: NAD_Gly3P_dh_C; pfam07479
218497003931	Pfam match to entry PF01210 NAD_Gly3P_dh, NAD-dependent glycerol-3-phosphate dehydrogenase , score 527.0, E-value 8.7e-156
218497003932	Chlamydia major outer membrane protein; Region: Chlam_OMP; pfam01308
218497003933	Signal peptide predicted for CAB881 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.459 between residues 30 and 31
218497003934	Protein of unknown function, DUF582; Region: DUF582; pfam04518
218497003935	Protein of unknown function, DUF582; Region: DUF582; pfam04518
218497003936	Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and...; Region: PEPCK_GTP; cd00819
218497003937	Phosphoenolpyruvate carboxykinase; Region: PEPCK; pfam00821
218497003938	active site
218497003939	substrate-binding site [chemical binding]; other site
218497003940	metal-binding site [ion binding]
218497003941	GTP binding site [chemical binding]; other site
218497003942	Pfam match to entry PF00821 PEPCK, Phosphoenolpyruvate carboxykinase , score 1254.5, E-value 0
218497003943	PS00505 Phosphoenolpyruvate carboxykinase (GTP) signature.
218497003944	rod shape-determining protein MreB; Provisional; Region: PRK13927
218497003945	Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton. Interaction with myosin provides the basis of muscular contraction and many aspects of cell motility. Each actin protomer binds one...; Region: ACTIN; cl11528
218497003946	ATP binding site [chemical binding]; other site
218497003947	profilin binding site; other site
218497003948	gelsolin binding site; other site
218497003949	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003950	Bacterial SNF2 helicase associated; Region: SNF2_assoc; pfam08455
218497003951	Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]; Region: HepA; COG0553
218497003952	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
218497003953	ATP binding site [chemical binding]; other site
218497003954	putative Mg++ binding site [ion binding]; other site
218497003955	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
218497003956	nucleotide binding region [chemical binding]; other site
218497003957	ATP-binding site [chemical binding]; other site
218497003958	Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain , score 94.4, E-value 1.5e-25
218497003959	Pfam match to entry PF00176 SNF2_N, SNF2 family N-terminal domain , score 299.6, E-value 2.4e-87
218497003960	trigger factor; Provisional; Region: tig; PRK01490
218497003961	Bacterial trigger factor protein (TF) C-terminus; Region: Trigger_C; pfam05698
218497003962	Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease; Region: S14_ClpP_2; cd07017
218497003963	oligomer interface [polypeptide binding]; other site
218497003964	active site residues [active]
218497003965	Pfam match to entry PF00574 CLP_protease, Clp protease , score 341.0, E-value 8.4e-100
218497003966	PS00225 Crystallins beta and gamma 'Greek key' motif signature.
218497003967	PS00381 Endopeptidase Clp serine active site.
218497003968	PS00382 Endopeptidase Clp histidine active site.
218497003969	ATP-dependent protease ATP-binding subunit ClpX; Provisional; Region: clpX; PRK05342
218497003970	ClpX C4-type zinc finger; Region: zf-C4_ClpX; cl05964
218497003971	The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC; Region: AAA; cd00009
218497003972	Walker A motif; other site
218497003973	ATP binding site [chemical binding]; other site
218497003974	Walker B motif; other site
218497003975	C-terminal, D2-small domain, of ClpB protein; Region: ClpB_D2-small; cl11083
218497003976	Pfam match to entry PF00004 AAA, ATPase associated with various cellular activities (AAA) , score 93.0, E-value 3.9e-25
218497003977	PS00017 ATP/GTP-binding site motif A (P-loop).
218497003978	tRNA nucleotidyltransferase/poly(A) polymerase [Translation, ribosomal structure and biogenesis]; Region: PcnB; COG0617
218497003979	Nucleotidyltransferase (NT) domain of ClassII CCA-adding enzymes; Region: NT_ClassII-CCAase; cd05398
218497003980	active site
218497003981	NTP binding site [chemical binding]; other site
218497003982	metal binding triad [ion binding]; metal-binding site
218497003983	Probable RNA and SrmB- binding site of polymerase A; Region: PolyA_pol_RNAbd; pfam12627
218497003984	Pfam match to entry PF01743 PolyA_pol, Poly A polymerase , score 236.2, E-value 3.1e-68
218497003985	PS00453 FKBP-type peptidyl-prolyl cis-trans isomerase signature 1.
218497003986	GTP-binding protein Der; Reviewed; Region: PRK00093
218497003987	EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an...; Region: EngA1; cd01894
218497003988	G1 box; other site
218497003989	GTP/Mg2+ binding site [chemical binding]; other site
218497003990	Switch I region; other site
218497003991	G2 box; other site
218497003992	Switch II region; other site
218497003993	G3 box; other site
218497003994	G4 box; other site
218497003995	G5 box; other site
218497003996	EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an...; Region: EngA2; cd01895
218497003997	G1 box; other site
218497003998	GTP/Mg2+ binding site [chemical binding]; other site
218497003999	Switch I region; other site
218497004000	G2 box; other site
218497004001	G3 box; other site
218497004002	Switch II region; other site
218497004003	G4 box; other site
218497004004	G5 box; other site
218497004005	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004006	Pfam match to entry PF01926 MMR_HSR1, GTPase of unknown function , score 262.8, E-value 3.1e-76
218497004007	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004008	Pseudogene. Similar to Chlamydophila caviae hypothetical protein CCA00924 SWALL:Q821L6 (EMBL:AE016997) (176 aa) fasta scores: E(): 1.3e-66, 90.9% id in 176 aa, N-terminal region similar to Chlamydia pneumoniae CT702 hypothetical protein CPN0843 or CPJ0843 or CP1026 SWALL:Q9Z763 (EMBL:AE001665) (66 aa) fasta scores: E(): 8.1e-10, 60.93% id in 64 aa, and C-terminal region to Chlamydia pneumoniae CT702 hypothetical protein CPN0842 or CPJ0842 SWALL:Q9Z764 (EMBL:AE001665) (58 aa) fasta scores: E(): 1.8e-07, 48.27% id in 58 aa. Note this CDS contains a framshift mutation following codon 112.;conserved hypothetical protein (pseudogene)
218497004009	preprotein translocase subunit SecA; Reviewed; Region: secA; PRK12899
218497004010	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497004011	SecA preprotein cross-linking domain; Region: SecA_PP_bind; cl03078
218497004012	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
218497004013	nucleotide binding region [chemical binding]; other site
218497004014	ATP-binding site [chemical binding]; other site
218497004015	Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain , score 4.4, E-value 0.0067
218497004016	PS01312 Protein secA signatures.
218497004017	Pfam match to entry PF01043 SecA_protein, SecA protein, amino terminal region , score 606.9, E-value 7.7e-180
218497004018	Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi; Region: TPR; cd00189
218497004019	binding surface
218497004020	TPR motif; other site
218497004021	putative PEP-CTERM system TPR-repeat lipoprotein; Region: PEP_TPR_lipo; TIGR02917
218497004022	1 probable transmembrane helix predicted for CAB895 by TMHMM2.0 at aa 36-58
218497004023	Phosphatidylserine decarboxylase; Region: PS_Dcarbxylase; cl03656
218497004024	Pfam match to entry PF02666 PS_Dcarbxylase, Phosphatidylserine decarboxylase , score 314.8, E-value 6.7e-92
218497004025	tRNA modification GTPase TrmE; Reviewed; Region: trmE; PRK05291
218497004026	GTP-binding protein TrmE N-terminus; Region: TrmE_N; pfam10396
218497004027	TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase...; Region: trmE; cd04164
218497004028	G1 box; other site
218497004029	GTP/Mg2+ binding site [chemical binding]; other site
218497004030	Switch I region; other site
218497004031	G2 box; other site
218497004032	Switch II region; other site
218497004033	G3 box; other site
218497004034	G4 box; other site
218497004035	G5 box; other site
218497004036	Catalytic cysteine-containing C-terminus of GTPase, MnmE; Region: GTPase_Cys_C; pfam12631
218497004037	Pfam match to entry PF01926 MMR_HSR1, GTPase of unknown function , score -15.5, E-value 1.1e-06
218497004038	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004039	Predicted EndoIII-related endonuclease [DNA replication, recombination, and repair]; Region: Nth; COG0177
218497004040	endonuclease III; includes endonuclease III (DNA-(apurinic or apyrimidinic site) lyase), alkylbase DNA glycosidases (Alka-family) and other DNA glycosidases; Region: ENDO3c; cd00056
218497004041	minor groove reading motif; other site
218497004042	helix-hairpin-helix signature motif; other site
218497004043	substrate binding pocket [chemical binding]; other site
218497004044	active site
218497004045	Pfam match to entry PF00730 HhH-GPD, HhH-GPD superfamily base excision DNA repair protein , score 208.2, E-value 8.3e-60
218497004046	Branched-chain amino acid transport protein; Region: Branch_AA_trans; cl00547
218497004047	10 probable transmembrane helices predicted for CAB899 by TMHMM2.0 at aa 20-42, 47-69, 90-112, 127-149, 156-178, 198-220, 249-271, 300-322, 334-356 and 366-388
218497004048	Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair]; Region: HepA; COG0553
218497004049	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
218497004050	ATP binding site [chemical binding]; other site
218497004051	putative Mg++ binding site [ion binding]; other site
218497004052	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
218497004053	nucleotide binding region [chemical binding]; other site
218497004054	ATP-binding site [chemical binding]; other site
218497004055	Pfam match to entry PF00176 SNF2_N, SNF2 family N-terminal domain , score 218.4, E-value 6.8e-63
218497004056	Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain , score 62.2, E-value 7e-16
218497004057	2 probable transmembrane helices predicted for CAB901 by TMHMM2.0 at aa 90-112 and 125-142
218497004058	dihydrolipoamide dehydrogenase; Validated; Region: PRK06327
218497004059	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497004060	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497004061	Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain; Region: Pyr_redox_dim; pfam02852
218497004062	Pfam match to entry PF00070 pyr_redox, Pyridine nucleotide-disulphide oxidoreductase , score 313.8, E-value 1.3e-91
218497004063	PS00076 Pyridine nucleotide-disulphide oxidoreductases class-I active site.
218497004064	Pfam match to entry PF02852 pyr_redox_dim, Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain , score 163.9, E-value 1.8e-46
218497004065	lipoyl synthase; Provisional; Region: PRK05481
218497004066	Radical SAM superfamily. Enzymes of this family generate radicals by combining a 4Fe-4S cluster and S-adenosylmethionine (SAM) in close proximity. They are characterized by a conserved CxxxCxxC motif, which coordinates the conserved iron-sulfur cluster; Region: Radical_SAM; cd01335
218497004067	FeS/SAM binding site; other site
218497004068	Pfam match to entry PF02546 Lipoate_synth, Lipoate synthase , score 593.5, E-value 8.4e-176
218497004069	Secretory protein of YscJ/FliF family; Region: YscJ_FliF; cl01907
218497004070	Signal peptide predicted for CAB904 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.730 between residues 24 and 25
218497004071	Pfam match to entry PF01514 YscJ_FliF, Secretory protein of YscJ/FliF family , score 99.1, E-value 5.7e-27
218497004072	1 probable transmembrane helix predicted for CAB904 by TMHMM2.0 at aa 238-260
218497004073	type III secretion system protein; Validated; Region: PRK06328
218497004074	Flagellar assembly protein FliH; Region: FliH; pfam02108
218497004075	FliP family; Region: FliP; cl00593
218497004076	FliP family; Region: FliP; cl00593
218497004077	Signal peptide predicted for CAB907 by SignalP 2.0 HMM (Signal peptide probabilty 0.987) with cleavage site probability 0.962 between residues 21 and 22
218497004078	4 probable transmembrane helices predicted for CAB907 by TMHMM2.0 at aa 92-114, 134-156, 246-268 and 278-300
218497004079	Pfam match to entry PF00813 FliP, FliP family , score 259.8, E-value 2.4e-75
218497004080	PS01061 Flagella transport protein fliP family signature 2.
218497004081	Bacterial export proteins, family 3; Region: Bac_export_3; cl00867
218497004082	Signal peptide predicted for CAB908 by SignalP 2.0 HMM (Signal peptide probabilty 0.657) with cleavage site probability 0.446 between residues 46 and 47
218497004083	Pfam match to entry PF01313 Bac_export_3, Bacterial export proteins, family 3 , score 101.6, E-value 9.9e-28
218497004084	2 probable transmembrane helices predicted for CAB908 by TMHMM2.0 at aa 21-43 and 53-75
218497004085	Bacterial export proteins, family 1; Region: Bac_export_1; cl00734
218497004086	Pfam match to entry PF01311 Bac_export_1, Bacterial export proteins, family 1 , score 50.2, E-value 2.9e-12
218497004087	5 probable transmembrane helices predicted for CAB909 by TMHMM2.0 at aa 26-48, 53-75, 88-110, 207-229 and 241-263
218497004088	2 probable transmembrane helices predicted for CAB910 by TMHMM2.0 at aa 59-81 and 112-134
218497004089	Signal peptide predicted for CAB911 by SignalP 2.0 HMM (Signal peptide probabilty 0.983) with cleavage site probability 0.636 between residues 22 and 23
218497004090	Protein of unknown function (DUF1494); Region: DUF1494; pfam07379
218497004091	1 probable transmembrane helix predicted for CAB912 by TMHMM2.0 at aa 4-21
218497004092	Signal peptide predicted for CAB913 by SignalP 2.0 HMM (Signal peptide probabilty 0.722) with cleavage site probability 0.394 between residues 42 and 43
218497004093	Type II secretory pathway, pseudopilin PulG [Cell motility and secretion / Intracellular trafficking and secretion]; Region: PulG; COG2165
218497004094	Prokaryotic N-terminal methylation motif; Region: N_methyl; cl06830
218497004095	Type II secretory pathway, component PulF [Cell motility and secretion / Intracellular trafficking and secretion]; Region: PulF; COG1459
218497004096	Bacterial type II secretion system protein F domain; Region: GSPII_F; cl00906
218497004097	Bacterial type II secretion system protein F domain; Region: GSPII_F; cl00906
218497004098	Pfam match to entry PF00482 GSPII_F, Bacterial type II secretion system protein F domain , score 187.4, E-value 1.5e-53
218497004099	3 probable transmembrane helices predicted for CAB915 by TMHMM2.0 at aa 166-188, 217-234 and 370-392
218497004100	GSPII_E N-terminal domain; Region: GSPII_E_N; pfam05157
218497004101	general secretory pathway protein E; Region: type_II_gspE; TIGR02533
218497004102	PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP). It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which...; Region: PulE-GspE; cd01129
218497004103	Walker A motif; other site
218497004104	ATP binding site [chemical binding]; other site
218497004105	Walker B motif; other site
218497004106	Pfam match to entry PF00437 GSPII_E, Type II/IV secretion system protein , score 543.9, E-value 6.9e-161
218497004107	PS00662 Bacterial type II secretion system protein E signature.
218497004108	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004109	Type II secretory pathway, component PulD [Cell motility and secretion / Intracellular trafficking and secretion]; Region: PulD; COG1450
218497004110	Bacterial type II/III secretion system short domain; Region: Secretin_N; pfam03958
218497004111	Bacterial type II/III secretion system short domain; Region: Secretin_N; pfam03958
218497004112	Bacterial type II and III secretion system protein; Region: Secretin; pfam00263
218497004113	Pfam match to entry PF00263 GSPII_III, Bacterial type II and III secretion system protein , score 240.6, E-value 1.4e-69
218497004114	Signal peptide predicted for CAB917 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.826 between residues 25 and 26
218497004115	Xaa-Pro aminopeptidase [Amino acid transport and metabolism]; Region: PepP; COG0006
218497004116	Creatinase/Prolidase N-terminal domain; Region: Creatinase_N; pfam01321
218497004117	Similar to Prolidase and Aminopeptidase P. The members of this subfamily presumably catalyse hydrolysis of Xaa-Pro dipeptides and/or release of any N-terminal amino acid, including proline, that is linked with proline; Region: APP-like; cd01092
218497004118	active site
218497004119	Pfam match to entry PF00557 Peptidase_M24, metallopeptidase M24 , score 216.4, E-value 2.8e-62
218497004120	DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair]; Region: MutL; COG0323
218497004121	Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins; Region: HATPase_c; cd00075
218497004122	ATP binding site [chemical binding]; other site
218497004123	Mg2+ binding site [ion binding]; other site
218497004124	G-X-G motif; other site
218497004125	MutL_Trans: transducer domain, having a ribosomal S5 domain 2-like fold, conserved in the C-terminal domain of DNA mismatch repair (MutL/MLH1/PMS2) family. This transducer domain is homologous to the second domain of the DNA gyrase B subunit, which is...; Region: MutL_Trans; cd00782
218497004126	ATP binding site [chemical binding]; other site
218497004127	MutL C terminal dimerisation domain; Region: MutL_C; cl07336
218497004128	Pfam match to entry PF01119 DNA_mis_repair, DNA mismatch repair protein, C-terminal domain , score 164.9, E-value 8.7e-47
218497004129	Pfam match to entry PF02518 HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase , score 26.1, E-value 5.3e-05
218497004130	PS00058 DNA mismatch repair proteins mutL / hexB / PMS1 signature.
218497004131	type III secretion low calcium response chaperone LcrH/SycD; Region: LcrH_SycD; TIGR02552
218497004132	Tetratricopeptide repeat; Region: TPR_3; pfam07720
218497004133	pathogenicity island 2 effector protein SseC; Provisional; Region: PRK15362
218497004134	Secretion system effector C (SseC) like family; Region: SseC; pfam04888
218497004135	putative DMT superfamily transporter inner membrane protein; Provisional; Region: PRK11272
218497004136	EamA-like transporter family; Region: EamA; cl01037
218497004137	Pfam match to entry PF00892 DUF6, Integral membrane protein DUF6 , score 71.0, E-value 1.7e-18
218497004138	9 probable transmembrane helices predicted for CAB925 by TMHMM2.0 at aa 28-50, 62-84, 94-111, 120-137, 147-169, 182-204, 214-236, 243-265 and 270-289
218497004139	Pfam match to entry PF00892 DUF6, Integral membrane protein DUF6 , score 97.5, E-value 1.7e-26
218497004140	Signal peptide predicted for CAB925 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.604 between residues 23 and 24
218497004141	threonyl-tRNA synthetase; Reviewed; Region: thrS; PRK00413
218497004142	The TGS domain, named after the ThrRS, GTPase, and SpoT/RelA proteins where it occurs, is structurally similar to ubiquitin. TGS is a small domain of about 50 amino acid residues with a predominantly beta-sheet structure. There is no direct information...; Region: TGS; cd01616
218497004143	Threonyl and Alanyl tRNA synthetase second additional domain; Region: tRNA_SAD; cl08469
218497004144	Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain. ThrRS is a homodimer. It is responsible for the attachment of threonine to the 3' OH group of ribose of the appropriate tRNA. This domain is primarily responsible for ATP-dependent...; Region: ThrRS_core; cd00771
218497004145	active site
218497004146	dimer interface [polypeptide binding]; other site
218497004147	motif 1; other site
218497004148	motif 2; other site
218497004149	motif 3; other site
218497004150	ThrRS Threonyl-anticodon binding domain. ThrRS belongs to class II aminoacyl-tRNA synthetases (aaRS). This alignment contains the anticodon binding domain, which is responsible for specificity in tRNA-binding, so that the activated amino acid is...; Region: ThrRS_anticodon; cd00860
218497004151	anticodon binding site; other site
218497004152	Pfam match to entry PF02824 TGS, TGS domain , score 33.0, E-value 4.4e-07
218497004153	Pfam match to entry PF00587 tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) , score 208.5, E-value 6.5e-60
218497004154	PS00179 Aminoacyl-transfer RNA synthetases class-II signature 1.
218497004155	PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2.
218497004156	Pfam match to entry PF03129 HGTP_anticodon, Anticodon binding domain , score 117.3, E-value 1.9e-32
218497004157	ATPases involved in chromosome partitioning [Cell division and chromosome partitioning]; Region: Soj; COG1192
218497004158	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497004159	Pfam match to entry PF00991 ParA, ParA family ATPase , score 85.5, E-value 7.1e-23
218497004160	Uncharacterised protein family (UPF0137); Region: UPF0137; pfam03677
218497004161	Pfam match to entry PF03677 UPF0137, Uncharacterised protein family (UPF0137) , score 495.2, E-value 3.3e-146
218497004162	tryptophanyl-tRNA synthetase II; Reviewed; Region: PRK12282
218497004163	catalytic core domain of tryptophanyl-tRNA synthetase; Region: TrpRS_core; cd00806
218497004164	active site
218497004165	HIGH motif; other site
218497004166	dimer interface [polypeptide binding]; other site
218497004167	KMSKS motif; other site
218497004168	Pfam match to entry PF00579 tRNA-synt_1b, tRNA synthetases class I (W and Y) , score 355.0, E-value 5.4e-104
218497004169	This hit extended beyond the end of the feature by 1 aa and was clipped.; Predicted helix-turn-helix motif with score 1163.000, SD 3.15 at aa 324-345, sequence ETMEEVHDTLGLSHKWRSRLLP
218497004170	excinuclease ABC subunit B; Provisional; Region: PRK05298
218497004171	DEAD-like helicases superfamily. A diverse family of proteins involved in ATP-dependent RNA or DNA unwinding. This domain contains the ATP-binding region; Region: DEXDc; cd00046
218497004172	ATP binding site [chemical binding]; other site
218497004173	Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may...; Region: HELICc; cd00079
218497004174	nucleotide binding region [chemical binding]; other site
218497004175	ATP-binding site [chemical binding]; other site
218497004176	Ultra-violet resistance protein B; Region: UvrB; pfam12344
218497004177	UvrB/uvrC motif; Region: UVR; pfam02151
218497004178	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004179	Pfam match to entry PF00271 helicase_C, Helicase conserved C-terminal domain , score 68.7, E-value 7.8e-18
218497004180	Pfam match to entry PF02151 UVR, UvrB/uvrC motif , score 33.9, E-value 2.5e-07
218497004181	enolase; Provisional; Region: eno; PRK00077
218497004182	Enolase: Enolases are homodimeric enzymes that catalyse the reversible dehydration of 2-phospho-D-glycerate to phosphoenolpyruvate as part of the glycolytic and gluconeogenesis pathways. The reaction is facilitated by the presence of metal ions; Region: enolase; cd03313
218497004183	dimer interface [polypeptide binding]; other site
218497004184	metal binding site [ion binding]; metal-binding site
218497004185	substrate binding pocket [chemical binding]; other site
218497004186	Pfam match to entry PF03952 enolase_N, Enolase, N-terminal domain , score 188.6, E-value 6.5e-54
218497004187	Pfam match to entry PF00113 enolase, Enolase, C-terminal TIM barrel domain , score 508.3, E-value 3.7e-150
218497004188	PS00164 Enolase signature.
218497004189	Serine phosphatase RsbU, regulator of sigma subunit [Signal transduction mechanisms / Transcription]; Region: RsbU; COG2208
218497004190	Histidine kinase, Adenylyl cyclase, Methyl-accepting protein, and Phosphatase (HAMP) domain. HAMP is a signaling domain which occurs in a wide variety of signaling proteins, many of which are bacterial. The HAMP domain consists of two alpha helices...; Region: HAMP; cl01054
218497004191	Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence...; Region: PP2Cc; cl00120
218497004192	2 probable transmembrane helices predicted for CAB933 by TMHMM2.0 at aa 10-32 and 305-324
218497004193	Pfam match to entry PF00672 HAMP, HAMP domain , score 31.7, E-value 1.1e-06
218497004194	Serine/threonine phosphatases, family 2C, catalytic domain; The protein architecture and deduced catalytic mechanism of PP2C phosphatases are similar to the PP1, PP2A, PP2B family of protein Ser/Thr phosphatases, with which PP2C shares no sequence...; Region: PP2Cc; cl00120
218497004195	Signal peptide predicted for CAB934 by SignalP 2.0 HMM (Signal peptide probabilty 0.999) with cleavage site probability 0.569 between residues 34 and 35
218497004196	2 probable transmembrane helices predicted for CAB934 by TMHMM2.0 at aa 273-291 and 298-315
218497004197	succinate dehydrogenase iron-sulfur subunit; Reviewed; Region: sdhB; PRK08640
218497004198	The HCP family of iron-sulfur proteins includes hybrid cluster protein (HCP), acetyl-CoA synthase (ACS), and carbon monoxide dehydrogenase (CODH), all of which contain [Fe4-S4] metal clusters at their active sites. These proteins have a conserved...; Region: HCP_like; cl14655
218497004199	PS00198 4Fe-4S ferredoxins, iron-sulfur binding region signature.
218497004200	succinate dehydrogenase flavoprotein subunit; Reviewed; Region: sdhA; PRK08641
218497004201	Rossmann-fold NAD(P)(+)-binding proteins; Region: NADB_Rossmann; cl09931
218497004202	domain; Region: Succ_DH_flav_C; pfam02910
218497004203	Pfam match to entry PF02910 succ_DH_flav_C, Fumarate reductase/succinate dehydrogenase flavoprotein C-terminal domain , score 177.6, E-value 1.3e-50
218497004204	Pfam match to entry PF00890 FAD_binding_2, FAD binding domain , score 302.3, E-value 3.9e-88
218497004205	PS00504 Fumarate reductase / succinate dehydrogenase FAD-binding site.
218497004206	Succinate:quinone oxidoreductase (SQR) Type B subfamily 1, transmembrane subunit; composed of proteins similar to Bacillus subtilis SQR. SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol. Bacillus subtilis...; Region: SQR_TypeB_1_TM; cd03497
218497004207	putative Iron-sulfur protein interface [polypeptide binding]; other site
218497004208	proximal heme binding site [chemical binding]; other site
218497004209	distal heme binding site [chemical binding]; other site
218497004210	putative dimer interface [polypeptide binding]; other site
218497004211	Succinate:quinone oxidoreductase (SQR) and Quinol:fumarate reductase (QFR) family, transmembrane subunits; SQR catalyzes the oxidation of succinate to fumarate coupled to the reduction of quinone to quinol, while QFR catalyzes the reverse reaction. SQR; Region: SQR_QFR_TM; cl00881
218497004212	proximal heme binding site [chemical binding]; other site
218497004213	Iron-sulfur protein interface; other site
218497004214	5 probable transmembrane helices predicted for CAB938 by TMHMM2.0 at aa 21-43, 74-96, 127-144, 232-254 and 275-297
218497004215	TatD like proteins;  E.coli TatD is a cytoplasmic protein, shown to have magnesium dependent DNase activity; Region: TatD_DNAse; cd01310
218497004216	active site
218497004217	Pfam match to entry PF01026 TatD_DNase, TatD related DNase , score 230.0, E-value 2.2e-66
218497004218	PS01091 Uncharacterized protein family UPF0006 signature 3.
218497004219	PS01090 Uncharacterized protein family UPF0006 signature 2.
218497004220	Uncharacterized protein predicted to be involved in C-type cytochrome biogenesis [Posttranslational modification, protein turnover, chaperones / Energy production and conversion]; Region: COG4233
218497004221	Cytochrome C biogenesis protein transmembrane region; Region: DsbD; cl00515
218497004222	DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD...; Region: DsbDgamma; cd02953
218497004223	DsbD alpha interface [polypeptide binding]; other site
218497004224	catalytic residues [active]
218497004225	PS00194 Thioredoxin family active site.
218497004226	8 probable transmembrane helices predicted for CAB940 by TMHMM2.0 at aa 321-343, 356-378, 398-420, 450-472, 482-501, 521-538, 542-564 and 577-596
218497004227	Pfam match to entry PF02683 DsbD, Cytochrome C biogenesis protein transmembrane region , score -8.7, E-value 1.2e-05
218497004228	MotA/TolQ/ExbB proton channel family; Region: MotA_ExbB; cl00568
218497004229	3 probable transmembrane helices predicted for CAB941 by TMHMM2.0 at aa 20-39, 135-157 and 177-199
218497004230	Pfam match to entry PF01618 MotA_ExbB, MotA/TolQ/ExbB proton channel family , score 171.4, E-value 9.8e-49
218497004231	Biopolymer transport protein ExbD/TolR; Region: ExbD; cl00537
218497004232	Pfam match to entry PF02472 ExbD, Biopolymer transport protein ExbD/TolR , score 31.7, E-value 4e-07
218497004233	1 probable transmembrane helix predicted for CAB942 by TMHMM2.0 at aa 13-35
218497004234	Signal peptide predicted for CAB943 by SignalP 2.0 HMM (Signal peptide probabilty 0.788) with cleavage site probability 0.706 between residues 16 and 17
218497004235	translocation protein TolB; Provisional; Region: tolB; PRK01029
218497004236	TolB amino-terminal domain; Region: TolB_N; cl00639
218497004237	WD40-like Beta Propeller Repeat; Region: PD40; pfam07676
218497004238	WD40-like Beta Propeller Repeat; Region: PD40; pfam07676
218497004239	WD40-like Beta Propeller Repeat; Region: PD40; pfam07676
218497004240	Signal peptide predicted for CAB944 by SignalP 2.0 HMM (Signal peptide probabilty 0.913) with cleavage site probability 0.879 between residues 30 and 31
218497004241	Peptidoglycan binding domains similar to the C-terminal domain of outer-membrane protein OmpA; Region: OmpA_C-like; cd07185
218497004242	ligand binding site [chemical binding]; other site
218497004243	Signal peptide predicted for CAB945 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.691 between residues 23 and 24
218497004244	Pfam match to entry PF00691 OmpA, OmpA family , score 107.2, E-value 2.1e-29
218497004245	chromosome segregation protein SMC, common bacterial type; Region: SMC_prok_B; TIGR02168
218497004246	Lysin domain, found in a variety of enzymes involved in bacterial cell wall degradation. This domain may have a general peptidoglycan binding function; Region: LysM; cd00118
218497004247	putative peptidoglycan binding site; other site
218497004248	Signal peptide predicted for CAB946 by SignalP 2.0 HMM (Signal peptide probabilty 0.995) with cleavage site probability 0.970 between residues 25 and 26
218497004249	Pfam match to entry PF01476 LysM, LysM domain , score 73.0, E-value 4e-19
218497004250	Peroxiredoxin [Posttranslational modification, protein turnover, chaperones]; Region: AhpC; COG0450
218497004251	Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides; Region: PRX_Typ2cys; cd03015
218497004252	dimer interface [polypeptide binding]; other site
218497004253	decamer (pentamer of dimers) interface [polypeptide binding]; other site
218497004254	catalytic triad [active]
218497004255	peroxidatic and resolving cysteines [active]
218497004256	Pfam match to entry PF00578 AhpC-TSA, AhpC/TSA family , score 247.6, E-value 1.1e-71
218497004257	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004258	chaperonin GroEL; Reviewed; Region: groEL; PRK12849
218497004259	GroEL_like type I chaperonin. Chaperonins are involved in productive folding of proteins. They share a common general morphology, a double toroid of 2 stacked rings, each composed of 7-9 subunits. The symmetry of type I is seven-fold and they are found...; Region: GroEL; cd03344
218497004260	ring oligomerisation interface [polypeptide binding]; other site
218497004261	ATP/Mg binding site [chemical binding]; other site
218497004262	stacking interactions; other site
218497004263	hinge regions; other site
218497004264	Pfam match to entry PF00118 cpn60_TCP1, TCP-1/cpn60 chaperonin family , score 436.8, E-value 1.3e-128
218497004265	Protein of unknown function (DUF1343); Region: DUF1343; cl01598
218497004266	PS00109 Tyrosine protein kinases specific active-site signature.
218497004267	Signal peptide predicted for CAB951 by SignalP 2.0 HMM (Signal peptide probabilty 0.985) with cleavage site probability 0.719 between residues 25 and 26
218497004268	NTPase/HAM1.  This family consists of the HAM1 protein and pyrophosphate-releasing xanthosine/ inosine triphosphatase. HAM1 protects the cell against mutagenesis by the base analog 6-N-hydroxylaminopurine (HAP) in E. Coli and S. cerevisiae. A...; Region: HAM1; cd00515
218497004269	active site
218497004270	dimerization interface [polypeptide binding]; other site
218497004271	Pfam match to entry PF01725 Ham1p_like, Ham1 family , score 189.5, E-value 3.4e-54
218497004272	Family 1 of Uracil-DNA glycosylase (UDG) enzymes; Region: UDG_F1; cd10027
218497004273	ligand binding site [chemical binding]; other site
218497004274	active site
218497004275	UGI interface [polypeptide binding]; other site
218497004276	catalytic site [active]
218497004277	Pfam match to entry PF03167 UDG, Uracil DNA glycosylase superfamily , score 249.7, E-value 2.6e-72
218497004278	PS00130 Uracil-DNA glycosylase signature.
218497004279	Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair]; Region: UvrD; COG0210
218497004280	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497004281	Pfam match to entry PF00580 UvrD-helicase, UvrD/REP helicase , score 714.2, E-value 3.8e-212
218497004282	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004283	RNA polymerase factor sigma-54; Reviewed; Region: PRK05932
218497004284	Sigma-54 factor, Activator interacting domain (AID); Region: Sigma54_AID; pfam00309
218497004285	Sigma-54 factor, core binding domain; Region: Sigma54_CBD; pfam04963
218497004286	Sigma-54, DNA binding domain; Region: Sigma54_DBD; pfam04552
218497004287	Pfam match to entry PF00309 Sigma54_factors, Sigma-54 factors family , score 376.0, E-value 2.4e-110
218497004288	Predicted helix-turn-helix motif with score 1005.000, SD 2.61 at aa 177-334, sequence CDFLRIAKKCHCSPSNLRYALKNALTTIPWCPAQGYASSSNIQPALPDVYVAKQDRV WEIQISSQGLPPIKLNREVFHIYEQLPREEKKSLTQQILSAKWLIKNLRKREQTLFS IVEKILPHQENFLLGKTSCPKPLSVKILSEELPYHESTIFRAIE
218497004289	PS00718 Sigma-54 factors family signature 2.
218497004290	1 probable transmembrane helix predicted for CAB957 by TMHMM2.0 at aa 178-200
218497004291	DNA topoisomerase I/SWI domain fusion protein; Validated; Region: PRK06319
218497004292	TOPRIM_TopoIA_TopoI: The topoisomerase-primase (TORPIM) domain found in members of the type IA family of DNA topoisomerases (Topo IA) similar to Escherichia coli DNA topoisomerase I.   Type IA DNA topoisomerases remove (relax) negative supercoils in the...; Region: TOPRIM_TopoIA_TopoI; cd03363
218497004293	active site
218497004294	interdomain interaction site; other site
218497004295	putative metal-binding site [ion binding]; other site
218497004296	nucleotide binding site [chemical binding]; other site
218497004297	DNA Topoisomerase, subtype IA; DNA-binding, ATP-binding and catalytic domain of bacterial DNA topoisomerases I and III, and eukaryotic DNA topoisomerase III and eubacterial and archael reverse gyrases. Topoisomerases clevage single or double stranded DNA...; Region: TOP1Ac; cd00186
218497004298	domain I; other site
218497004299	DNA binding groove [nucleotide binding]
218497004300	phosphate binding site [ion binding]; other site
218497004301	domain II; other site
218497004302	domain III; other site
218497004303	nucleotide binding site [chemical binding]; other site
218497004304	catalytic site [active]
218497004305	domain IV; other site
218497004306	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
218497004307	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
218497004308	Topoisomerase DNA binding C4 zinc finger; Region: zf-C4_Topoisom; pfam01396
218497004309	SWIB/MDM2 domain; Region: SWIB; cl02489
218497004310	Pfam match to entry PF01751 Toprim, Toprim domain , score 125.1, E-value 8.6e-35
218497004311	Pfam match to entry PF01131 Topoisom_bac, DNA topoisomerase , score 497.8, E-value 5.3e-147
218497004312	PS00396 Prokaryotic DNA topoisomerase I active site.
218497004313	Pfam match to entry PF01396 zf-C4_Topoisom, Topoisomerase DNA binding C4 zinc finger , score 24.1, E-value 8.6e-05
218497004314	Pfam match to entry PF01396 zf-C4_Topoisom, Topoisomerase DNA binding C4 zinc finger , score 53.9, E-value 2.3e-13
218497004315	Pfam match to entry PF01396 zf-C4_Topoisom, Topoisomerase DNA binding C4 zinc finger , score 27.5, E-value 2.1e-05
218497004316	Pfam match to entry PF02201 SWIB, BAF60b domain of the SWIB complex , score 113.0, E-value 3.8e-31
218497004317	putative TIM-barrel protein, nifR3 family; Region: nifR3_yhdG; TIGR00737
218497004318	Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also...; Region: DUS_like_FMN; cd02801
218497004319	FMN binding site [chemical binding]; other site
218497004320	active site
218497004321	catalytic residues [active]
218497004322	substrate binding site [chemical binding]; other site
218497004323	Pfam match to entry PF01207 UPF0034, Dihydrouridine synthase (Dus) , score 222.9, E-value 3e-64
218497004324	PS01136 Uncharacterized protein family UPF0034 signature.
218497004325	YGGT family; Region: YGGT; cl00508
218497004326	Pfam match to entry PF02325 YGGT, YGGT family , score 104.1, E-value 1.8e-28
218497004327	2 probable transmembrane helices predicted for CAB960 by TMHMM2.0 at aa 5-27 and 56-78
218497004328	Signal peptide predicted for CAB962 by SignalP 2.0 HMM (Signal peptide probabilty 0.998) with cleavage site probability 0.649 between residues 29 and 30
218497004329	PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
218497004330	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2849
218497004331	Uncharacterized protein conserved in bacteria [Function unknown]; Region: COG2849
218497004332	Signal peptide predicted for CAB963 by SignalP 2.0 HMM (Signal peptide probabilty 1.000) with cleavage site probability 0.923 between residues 22 and 23
218497004333	5-formyltetrahydrofolate cyclo-ligase family; Region: 5-FTHF_cyc-lig; cl00360
218497004334	Pfam match to entry PF01812 5-FTHF_cyc-lig, 5-formyltetrahydrofolate cyclo-ligase , score 113.5, E-value 2.6e-31
218497004335	RecA is a  bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response.  RecA couples ATP hydrolysis to DNA strand exchange; Region: recA; cd00983
218497004336	protein RecA; Region: tigrfam_recA; TIGR02012
218497004337	hexamer interface [polypeptide binding]; other site
218497004338	Walker A motif; other site
218497004339	ATP binding site [chemical binding]; other site
218497004340	Walker B motif; other site
218497004341	Pfam match to entry PF00154 recA, recA bacterial DNA recombination protein , score 703.9, E-value 4.8e-209
218497004342	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004343	PS00321 recA signature.
218497004344	Heme oxygenase catalyzes the rate limiting step in the degradation of heme to bilirubin, it is essential for recycling of iron from heme. Heme is used as a substrate and cofactor for its own degradation to biliverdin, iron, and carbon monoxide. This...; Region: HemeO; cl15243
218497004345	GTP and metal dependent enzyme involved F420 coenzyme biosynthesis (catalyzes addition of two l-glutamates to F420 precursor) [Coenzyme transport and metabolism]; Region: COG1478
218497004346	F420-0:Gamma-glutamyl ligase; Region: F420_ligase; cl00644
218497004347	Pfam match to entry PF01996 DUF129, Protein of unknown function DUF129 , score 235.8, E-value 4.1e-68
218497004348	Dihydrofolate reductase (DHFR). Reduces 7,8-dihydrofolate to 5,6,7,8-tetrahydrofolate with NADPH as a cofactor. This is an essential step in the biosynthesis of deoxythymidine phosphate since 5,6,7,8-tetrahydrofolate is required to regenerate 5; Region: DHFR; cd00209
218497004349	folate binding site [chemical binding]; other site
218497004350	NADP+ binding site [chemical binding]; other site
218497004351	Pfam match to entry PF00186 DiHfolate_red, Dihydrofolate reductase , score 97.2, E-value 2.1e-26
218497004352	PS00075 Dihydrofolate reductase signature.
218497004353	7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK). Folate derivatives are essential cofactors in the biosynthesis of purines, pyrimidines, and amino acids as well as formyl-tRNA. Mammalian cells are able to utilize pre-formed folates after...; Region: HPPK; cd00483
218497004354	catalytic center binding site [active]
218497004355	ATP binding site [chemical binding]; other site
218497004356	DHPS subgroup of Pterin binding enzymes. DHPS (dihydropteroate synthase), a functional homodimer, catalyzes the condensation of p-aminobenzoic acid (pABA) in the de novo biosynthesis of folate, which is an essential cofactor in both nucleic acid and...; Region: DHPS; cd00739
218497004357	dihydropteroate synthase; Region: DHPS; TIGR01496
218497004358	substrate binding pocket [chemical binding]; other site
218497004359	dimer interface [polypeptide binding]; other site
218497004360	inhibitor binding site; inhibition site
218497004361	Pfam match to entry PF00809 Pterin_bind, Pterin binding enzyme , score 270.4, E-value 1.5e-78
218497004362	Pfam match to entry PF01288 HPPK, 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK) , score 201.4, E-value 8.9e-58
218497004363	Similar to Bacillus subtilis dihydroneopterin aldolase FolB or FolA SWALL:FOLB_BACSU (SWALL:P28823) (120 aa) fasta scores: E(): 0.2, 25.64% id in 78 aa, and to Chlamydia pneumoniae probable dihydroneopterin aldolase FolB SWALL:FOLB_CHLPN (SWALL:Q9Z7E9) (134 aa) fasta scores: E(): 2.5e-30, 62.4% id in 125 aa. Note lacks any obvious and appropriate translational start site.;dihydroneopterin aldolase (pseudogene)
218497004364	Pfam match to entry PF02152 FolB, Dihydroneopterin aldolase , score 119.0, E-value 6e-33
218497004365	RNA polymerase sigma factor RpoD; Validated; Region: PRK05658
218497004366	Sigma-70 factor, region 1.1; Region: Sigma70_r1_1; pfam03979
218497004367	Sigma-70 factor, region 1.2; Region: Sigma70_r1_2; pfam00140
218497004368	RNA polymerase sigma factor RpoD, C-terminal domain; Region: RpoD_Cterm; TIGR02393
218497004369	Sigma-70 region 2; Region: Sigma70_r2; pfam04542
218497004370	Sigma-70 region 3; Region: Sigma70_r3; pfam04539
218497004371	Sigma70, region (SR) 4 refers to the most C-terminal of four conserved domains found in Escherichia coli (Ec) sigma70, the main housekeeping sigma, and related sigma-factors (SFs). A SF is a dissociable subunit of RNA polymerase, it directs bacterial or...; Region: Sigma70_r4; cd06171
218497004372	DNA binding residues [nucleotide binding]
218497004373	PS00716 Sigma-70 factors family signature 2.
218497004374	Predicted helix-turn-helix motif with score 1686.000, SD 4.93 at aa 519-540, sequence KTLEEVGSAFNVTRERIRQIEA
218497004375	Predicted helix-turn-helix motif with score 1296.000, SD 3.60 at aa 426-447, sequence PTPEELAEELGLTPDRVREIYK
218497004376	PS00715 Sigma-70 factors family signature 1.
218497004377	PS00030 Eukaryotic  RNA-binding region RNP-1 signature.
218497004378	Pfam match to entry PF00140 sigma70_r1_2, Sigma-70 factor, region 1.2 , score 71.7, E-value 1e-18
218497004379	Pfam match to entry PF03979 sigma70_r1_1, Sigma-70 factor, region 1.1 , score 94.5, E-value 1.4e-25
218497004380	Uncharacterised protein family (UPF0242); Region: UPF0242; pfam06785
218497004381	probable transmembrane helices predicted for CAB972 by TMHMM2.0 at aa 41-58
218497004382	Signal peptide predicted for CAB972 by SignalP 2.0 HMM (Signal peptide probabilty 0.852) with cleavage site probability 0.422 between residues 37 and 38
218497004383	Ribosomal protein S20; Region: Ribosomal_S20p; cl00384
218497004384	Pfam match to entry PF01649 Ribosomal_S20p, Ribosomal protein S20 , score 77.7, E-value 1.6e-20
218497004385	PS00402 Binding-protein-dependent transport systems inner membrane comp. sign.
218497004386	1 probable transmembrane helix predicted for CAB974 by TMHMM2.0 at aa 249-271
218497004387	exodeoxyribonuclease V, alpha subunit; Region: recD; TIGR01447
218497004388	P-loop containing Nucleoside Triphosphate Hydrolases; Region: P-loop_NTPase; cl09099
218497004389	PS00017 ATP/GTP-binding site motif A (P-loop).
218497004390	Protein of unknown function (DUF1347); Region: DUF1347; pfam07079
218497004391	Signal peptide predicted for CAB976 by SignalP 2.0 HMM (Signal peptide probabilty 0.997) with cleavage site probability 0.397 between residues 40 and 41
218497004392	Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription]; Region: OmpR; COG0745
218497004393	Effector domain of response regulator. Bacteria and certain eukaryotes like protozoa and higher plants use two-component signal transduction systems to detect and respond to changes in the environment. The system consists of a sensor histidine kinase and...; Region: trans_reg_C; cd00383
218497004394	DNA binding site [nucleotide binding]
218497004395	Pfam match to entry PF00486 trans_reg_C, Transcriptional regulatory protein, C terminal , score 34.6, E-value 1.4e-07
218497004396	Left-handed parallel beta-Helix (LbetaH or LbH) domain: The alignment contains 5 turns, each containing three imperfect tandem repeats of a hexapeptide repeat motif (X-[STAV]-X-[LIV]-[GAED]-X). Proteins containing hexapeptide repeats are often enzymes...; Region: LbetaH; cl00160
218497004397	putative trimer interface [polypeptide binding]; other site
218497004398	putative CoA binding site [chemical binding]; other site
218497004399	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 11.3, E-value 1.5
218497004400	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 6.4, E-value 7.2
218497004401	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 3.9, E-value 15
218497004402	Pfam match to entry PF00132 hexapep, Bacterial transferase hexapeptide (four repeats) , score 14.2, E-value 0.21
218497004403	Isoprenoid Biosynthesis enzymes, Class 1; Region: Isoprenoid_Biosyn_C1; cl00210
218497004404	substrate binding pocket [chemical binding]; other site
218497004405	aspartate-rich region 1; other site
218497004406	Pfam match to entry PF00348 polyprenyl_synt, Polyprenyl synthetase , score 114.5, E-value 1.3e-31
218497004407	PS00723 Polyprenyl synthetases signature 1.
218497004408	PS00444 Polyprenyl synthetases signature 2.
218497004409	Thymidylate synthase complementing protein; Region: Thy1; cl03630
218497004410	Thymidylate synthase complementing protein; Region: Thy1; cl03630
218497004411	Pfam match to entry PF02511 Thy1, Thymidylate synthase complementing protein , score -60.9, E-value 0.0024